Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165B9Z9

Protein Details
Accession A0A165B9Z9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
117-143VPTSHPRRGHAHRKRGRVLRPPSRYCABasic
NLS Segment(s)
PositionSequence
122-136PRRGHAHRKRGRVLR
Subcellular Location(s) mito 19, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MKTTRKKAGSAAAFDKIDREYVVNAARAAKSDDSSLPQRLLYVSVGGANPNSWESYWRSKGITEQKLAELGYNDTIIFRPGILPGEADRGETRVMESIATSVLWLASKVSSSVYMPVPTSHPRRGHAHRKRGRVLRPPSRYCAEGRQPEGPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.32
4 0.27
5 0.21
6 0.18
7 0.13
8 0.16
9 0.19
10 0.19
11 0.19
12 0.21
13 0.2
14 0.2
15 0.22
16 0.2
17 0.17
18 0.18
19 0.19
20 0.2
21 0.24
22 0.25
23 0.23
24 0.21
25 0.21
26 0.19
27 0.19
28 0.15
29 0.11
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.08
36 0.08
37 0.08
38 0.08
39 0.07
40 0.09
41 0.13
42 0.21
43 0.24
44 0.24
45 0.25
46 0.24
47 0.32
48 0.39
49 0.4
50 0.34
51 0.32
52 0.31
53 0.32
54 0.31
55 0.25
56 0.16
57 0.12
58 0.1
59 0.09
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.11
73 0.11
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.11
80 0.08
81 0.09
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.11
100 0.12
101 0.13
102 0.14
103 0.15
104 0.18
105 0.24
106 0.29
107 0.34
108 0.36
109 0.39
110 0.47
111 0.55
112 0.62
113 0.66
114 0.71
115 0.71
116 0.77
117 0.83
118 0.83
119 0.83
120 0.82
121 0.82
122 0.82
123 0.84
124 0.81
125 0.78
126 0.73
127 0.66
128 0.6
129 0.6
130 0.59
131 0.57
132 0.57