Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4W0H5

Protein Details
Accession J4W0H5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AMASPASHKPRRKGKTNGVDLDVHydrophilic
NLS Segment(s)
PositionSequence
11-14PRRK
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004856  Glyco_trans_ALG6/ALG8  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0042283  F:dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase activity  
GO:0042281  F:dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity  
GO:0006487  P:protein N-linked glycosylation  
Pfam View protein in Pfam  
PF03155  Alg6_Alg8  
Amino Acid Sequences MAMASPASHKPRRKGKTNGVDLDVRPRAEAPSKAPLFPLAGFLWPLRTASSQWTVLPLVLMVAGLFRWAAGLWGYSGFERPPMFGDYEAQRHWMEITTHLPISQWYFHDLEWWGLDYPPLTAYHSWLLGKIGALFDPAWFALFTSRGSHDANLKVFMRATVIVSEYLTYIPAVVVFVRRFSRLSGVPAWASNVALVAILMQPGTILVDHIHFQYNTVMLGLVLASMSSLLAERYRWAAVFFVGALGFKQMALYYAFSVFAYLLGRCIKPSISIGRLVGIALVTLISFAVLVLPIVAGALYDARRGISSRPELGGPPPPLPIFSFLSNHLDTEAFYYPVVEQLVQLVHRVFPFARGLFEDKVANFWCAANVVIKLRKYPSDLLQKASLAFTLLAVIPPNLILFIKPLKATMPLAFATTAWGFFLFSYQVHEKSVLLPLMPMTMLLAGKQGLNGSVRSWVGFANILGAWTMFPLLQRVDLAVPYAVLTLLWAYLLGLPPVSWTAPLQDTHTKPLVQYATLALHSGFYVLMAAWHIAQAILPPPPSKPDLWIVANVGIGAAGFMICYVWCFWRLIVESDLLPNASKTSKAKKIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.85
4 0.87
5 0.84
6 0.78
7 0.75
8 0.67
9 0.66
10 0.59
11 0.49
12 0.4
13 0.34
14 0.34
15 0.34
16 0.37
17 0.32
18 0.38
19 0.4
20 0.4
21 0.4
22 0.37
23 0.34
24 0.3
25 0.29
26 0.2
27 0.19
28 0.2
29 0.19
30 0.2
31 0.18
32 0.18
33 0.16
34 0.17
35 0.17
36 0.22
37 0.27
38 0.25
39 0.25
40 0.28
41 0.26
42 0.24
43 0.23
44 0.16
45 0.11
46 0.09
47 0.09
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.06
59 0.07
60 0.08
61 0.09
62 0.09
63 0.11
64 0.11
65 0.14
66 0.14
67 0.14
68 0.16
69 0.18
70 0.19
71 0.18
72 0.23
73 0.23
74 0.28
75 0.28
76 0.28
77 0.25
78 0.25
79 0.25
80 0.24
81 0.2
82 0.19
83 0.21
84 0.22
85 0.22
86 0.22
87 0.21
88 0.19
89 0.22
90 0.21
91 0.19
92 0.19
93 0.2
94 0.2
95 0.23
96 0.23
97 0.21
98 0.18
99 0.19
100 0.16
101 0.14
102 0.15
103 0.11
104 0.11
105 0.11
106 0.11
107 0.12
108 0.11
109 0.14
110 0.16
111 0.18
112 0.17
113 0.17
114 0.17
115 0.15
116 0.15
117 0.13
118 0.12
119 0.09
120 0.1
121 0.1
122 0.09
123 0.09
124 0.09
125 0.08
126 0.07
127 0.08
128 0.08
129 0.09
130 0.1
131 0.12
132 0.13
133 0.16
134 0.17
135 0.19
136 0.22
137 0.26
138 0.26
139 0.27
140 0.27
141 0.25
142 0.24
143 0.22
144 0.19
145 0.15
146 0.14
147 0.11
148 0.12
149 0.11
150 0.11
151 0.11
152 0.1
153 0.09
154 0.08
155 0.07
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.09
162 0.09
163 0.12
164 0.14
165 0.15
166 0.16
167 0.17
168 0.21
169 0.19
170 0.23
171 0.22
172 0.23
173 0.23
174 0.22
175 0.23
176 0.18
177 0.16
178 0.12
179 0.09
180 0.07
181 0.06
182 0.05
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.03
189 0.03
190 0.04
191 0.03
192 0.03
193 0.04
194 0.05
195 0.06
196 0.07
197 0.1
198 0.09
199 0.1
200 0.11
201 0.11
202 0.1
203 0.09
204 0.08
205 0.06
206 0.06
207 0.05
208 0.04
209 0.03
210 0.03
211 0.02
212 0.02
213 0.02
214 0.02
215 0.03
216 0.03
217 0.04
218 0.04
219 0.05
220 0.07
221 0.08
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.07
228 0.06
229 0.06
230 0.05
231 0.05
232 0.05
233 0.05
234 0.04
235 0.04
236 0.04
237 0.05
238 0.06
239 0.07
240 0.07
241 0.07
242 0.08
243 0.08
244 0.08
245 0.07
246 0.06
247 0.07
248 0.06
249 0.07
250 0.09
251 0.09
252 0.09
253 0.1
254 0.09
255 0.1
256 0.12
257 0.14
258 0.14
259 0.16
260 0.16
261 0.16
262 0.16
263 0.14
264 0.12
265 0.07
266 0.06
267 0.04
268 0.04
269 0.03
270 0.02
271 0.02
272 0.02
273 0.02
274 0.02
275 0.02
276 0.02
277 0.02
278 0.02
279 0.02
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.03
286 0.04
287 0.04
288 0.04
289 0.05
290 0.05
291 0.06
292 0.08
293 0.12
294 0.15
295 0.16
296 0.17
297 0.17
298 0.18
299 0.19
300 0.24
301 0.2
302 0.18
303 0.18
304 0.17
305 0.18
306 0.18
307 0.19
308 0.15
309 0.14
310 0.15
311 0.15
312 0.2
313 0.19
314 0.19
315 0.16
316 0.14
317 0.12
318 0.14
319 0.14
320 0.09
321 0.09
322 0.1
323 0.09
324 0.1
325 0.11
326 0.07
327 0.06
328 0.07
329 0.08
330 0.08
331 0.09
332 0.08
333 0.08
334 0.08
335 0.1
336 0.09
337 0.1
338 0.13
339 0.12
340 0.13
341 0.13
342 0.17
343 0.17
344 0.18
345 0.17
346 0.14
347 0.17
348 0.17
349 0.16
350 0.12
351 0.12
352 0.1
353 0.09
354 0.1
355 0.08
356 0.09
357 0.12
358 0.15
359 0.16
360 0.18
361 0.19
362 0.21
363 0.23
364 0.25
365 0.29
366 0.36
367 0.38
368 0.38
369 0.39
370 0.37
371 0.34
372 0.31
373 0.23
374 0.13
375 0.12
376 0.08
377 0.07
378 0.07
379 0.07
380 0.07
381 0.07
382 0.06
383 0.06
384 0.06
385 0.05
386 0.05
387 0.05
388 0.07
389 0.09
390 0.11
391 0.11
392 0.11
393 0.12
394 0.14
395 0.16
396 0.15
397 0.16
398 0.15
399 0.16
400 0.15
401 0.14
402 0.15
403 0.13
404 0.12
405 0.09
406 0.09
407 0.08
408 0.07
409 0.09
410 0.07
411 0.06
412 0.12
413 0.15
414 0.15
415 0.16
416 0.17
417 0.16
418 0.17
419 0.21
420 0.16
421 0.13
422 0.13
423 0.12
424 0.12
425 0.11
426 0.09
427 0.06
428 0.07
429 0.07
430 0.07
431 0.08
432 0.07
433 0.07
434 0.08
435 0.08
436 0.08
437 0.1
438 0.1
439 0.1
440 0.13
441 0.13
442 0.13
443 0.13
444 0.11
445 0.11
446 0.12
447 0.11
448 0.1
449 0.1
450 0.1
451 0.09
452 0.09
453 0.07
454 0.07
455 0.07
456 0.05
457 0.05
458 0.07
459 0.08
460 0.09
461 0.09
462 0.1
463 0.11
464 0.11
465 0.12
466 0.1
467 0.09
468 0.09
469 0.09
470 0.07
471 0.06
472 0.06
473 0.05
474 0.04
475 0.04
476 0.04
477 0.04
478 0.06
479 0.07
480 0.07
481 0.07
482 0.07
483 0.08
484 0.1
485 0.09
486 0.09
487 0.08
488 0.12
489 0.15
490 0.16
491 0.2
492 0.27
493 0.29
494 0.35
495 0.38
496 0.35
497 0.32
498 0.38
499 0.35
500 0.27
501 0.26
502 0.23
503 0.22
504 0.22
505 0.22
506 0.15
507 0.13
508 0.13
509 0.12
510 0.09
511 0.06
512 0.06
513 0.05
514 0.06
515 0.06
516 0.07
517 0.06
518 0.07
519 0.07
520 0.06
521 0.06
522 0.08
523 0.1
524 0.12
525 0.14
526 0.15
527 0.16
528 0.21
529 0.24
530 0.23
531 0.24
532 0.27
533 0.32
534 0.34
535 0.35
536 0.33
537 0.32
538 0.31
539 0.26
540 0.2
541 0.14
542 0.11
543 0.08
544 0.05
545 0.03
546 0.03
547 0.03
548 0.03
549 0.03
550 0.05
551 0.07
552 0.09
553 0.11
554 0.12
555 0.13
556 0.19
557 0.22
558 0.25
559 0.25
560 0.25
561 0.24
562 0.26
563 0.27
564 0.21
565 0.19
566 0.15
567 0.16
568 0.15
569 0.19
570 0.24
571 0.32