Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CQP3

Protein Details
Accession A0A165CQP3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-114GRPKDRVPARHCRPRKVRNKGIRSTLSIBasic
NLS Segment(s)
PositionSequence
99-104RPRKVR
Subcellular Location(s) mito 17, cyto 4, cyto_nucl 3.833, cyto_pero 3.333, nucl 2.5, pero 1.5
Family & Domain DBs
Amino Acid Sequences MLVTNFSSTRFKWLLNTARVCDRDTVTCRCGAEERLTLWLRKGCPWRMVNSLGGGNGVVPHYSGTTLDAQVRYAAGTRELLENCLIGRPKDRVPARHCRPRKVRNKGIRSTLSIYGQGDQGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.5
4 0.46
5 0.52
6 0.53
7 0.5
8 0.44
9 0.37
10 0.36
11 0.36
12 0.39
13 0.33
14 0.34
15 0.33
16 0.31
17 0.31
18 0.27
19 0.27
20 0.24
21 0.23
22 0.27
23 0.28
24 0.26
25 0.27
26 0.28
27 0.25
28 0.28
29 0.34
30 0.31
31 0.37
32 0.39
33 0.4
34 0.4
35 0.41
36 0.36
37 0.31
38 0.28
39 0.2
40 0.18
41 0.14
42 0.09
43 0.07
44 0.06
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.07
53 0.08
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.08
60 0.08
61 0.08
62 0.07
63 0.08
64 0.08
65 0.12
66 0.12
67 0.13
68 0.12
69 0.12
70 0.11
71 0.14
72 0.15
73 0.12
74 0.15
75 0.18
76 0.2
77 0.29
78 0.34
79 0.38
80 0.44
81 0.55
82 0.61
83 0.68
84 0.71
85 0.73
86 0.79
87 0.81
88 0.85
89 0.85
90 0.86
91 0.86
92 0.9
93 0.87
94 0.86
95 0.81
96 0.76
97 0.7
98 0.64
99 0.57
100 0.5
101 0.43
102 0.35