Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BLW2

Protein Details
Accession A0A165BLW2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-29LEARRRPWRSHQPRLLRSQEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MGGVIWAATLEARRRPWRSHQPRLLRSQEQTAGAAAGRRVHLAQEEVELHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.49
4 0.57
5 0.64
6 0.7
7 0.73
8 0.75
9 0.77
10 0.8
11 0.77
12 0.69
13 0.6
14 0.54
15 0.47
16 0.38
17 0.32
18 0.25
19 0.19
20 0.16
21 0.15
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.12
28 0.14
29 0.15
30 0.15
31 0.17