Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165H6Z9

Protein Details
Accession A0A165H6Z9    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
111-131DKDRRAILDRKDRKKTSKLSVBasic
NLS Segment(s)
PositionSequence
11-30RRKSRKAHFSAPSSVRRKIM
35-42AKELRAKH
123-124RK
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKFNPDVSSSRRKSRKAHFSAPSSVRRKIMSSALAKELRAKHNTRSLPIRKDDEVRIVRGKYRGREGKVTQVYRKKWVIHVDRVQRDKSNGATVPIGIHPSNVVITTIKLDKDRRAILDRKDRKKTSKLSVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.74
4 0.79
5 0.77
6 0.74
7 0.77
8 0.75
9 0.74
10 0.68
11 0.63
12 0.57
13 0.5
14 0.46
15 0.4
16 0.39
17 0.36
18 0.36
19 0.35
20 0.39
21 0.39
22 0.37
23 0.4
24 0.4
25 0.39
26 0.4
27 0.4
28 0.38
29 0.45
30 0.47
31 0.45
32 0.49
33 0.51
34 0.51
35 0.53
36 0.52
37 0.46
38 0.47
39 0.45
40 0.44
41 0.39
42 0.36
43 0.35
44 0.31
45 0.32
46 0.34
47 0.36
48 0.3
49 0.36
50 0.39
51 0.38
52 0.43
53 0.42
54 0.46
55 0.49
56 0.5
57 0.48
58 0.5
59 0.49
60 0.49
61 0.51
62 0.43
63 0.4
64 0.46
65 0.46
66 0.47
67 0.52
68 0.56
69 0.59
70 0.61
71 0.59
72 0.52
73 0.48
74 0.42
75 0.36
76 0.32
77 0.26
78 0.24
79 0.22
80 0.2
81 0.2
82 0.18
83 0.19
84 0.13
85 0.12
86 0.1
87 0.11
88 0.11
89 0.1
90 0.1
91 0.07
92 0.08
93 0.11
94 0.13
95 0.15
96 0.19
97 0.22
98 0.26
99 0.33
100 0.36
101 0.38
102 0.44
103 0.49
104 0.53
105 0.61
106 0.66
107 0.7
108 0.76
109 0.78
110 0.79
111 0.82
112 0.81