Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165FI66

Protein Details
Accession A0A165FI66    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-42TICRAFSNISCRRKKKRSPGNGHERPVSHydrophilic
NLS Segment(s)
PositionSequence
27-33RKKKRSP
Subcellular Location(s) mito 16, nucl 6, extr 3
Family & Domain DBs
Amino Acid Sequences MRQGLLQPIPLLLHTICRAFSNISCRRKKKRSPGNGHERPVSNPGATTFLPSSTLCCVHHIGIRRHSSLGSHTCSSLTRTLIVELQTRLPVQCHKIPRRERGRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.16
5 0.18
6 0.17
7 0.2
8 0.26
9 0.33
10 0.42
11 0.51
12 0.58
13 0.67
14 0.75
15 0.82
16 0.83
17 0.85
18 0.86
19 0.88
20 0.9
21 0.91
22 0.89
23 0.82
24 0.76
25 0.67
26 0.58
27 0.51
28 0.42
29 0.31
30 0.23
31 0.2
32 0.18
33 0.17
34 0.17
35 0.13
36 0.11
37 0.13
38 0.13
39 0.13
40 0.11
41 0.13
42 0.11
43 0.13
44 0.14
45 0.13
46 0.16
47 0.22
48 0.25
49 0.31
50 0.34
51 0.33
52 0.32
53 0.31
54 0.3
55 0.29
56 0.29
57 0.26
58 0.24
59 0.23
60 0.23
61 0.24
62 0.26
63 0.23
64 0.19
65 0.16
66 0.16
67 0.17
68 0.19
69 0.2
70 0.21
71 0.19
72 0.2
73 0.2
74 0.21
75 0.2
76 0.2
77 0.23
78 0.26
79 0.32
80 0.4
81 0.47
82 0.56
83 0.64
84 0.72