Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DSD6

Protein Details
Accession A0A165DSD6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-120PLDLRPKKTRAIRRRLTPHEKSRKTLKQHKKDIHFPLRKYBasic
NLS Segment(s)
PositionSequence
84-115LRPKKTRAIRRRLTPHEKSRKTLKQHKKDIHF
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLVELKEELLALRVQKIAGGSAAKLTKINTVRKSIARVMTVMNQKQRQNLREFYKSKKYLPLDLRPKKTRAIRRRLTPHEKSRKTLKQHKKDIHFPLRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.51
9 0.46
10 0.43
11 0.41
12 0.32
13 0.27
14 0.22
15 0.19
16 0.12
17 0.12
18 0.1
19 0.11
20 0.11
21 0.1
22 0.1
23 0.1
24 0.09
25 0.1
26 0.1
27 0.08
28 0.11
29 0.12
30 0.12
31 0.12
32 0.13
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.3
44 0.27
45 0.24
46 0.26
47 0.3
48 0.29
49 0.3
50 0.31
51 0.32
52 0.37
53 0.41
54 0.39
55 0.39
56 0.43
57 0.43
58 0.48
59 0.5
60 0.5
61 0.55
62 0.54
63 0.51
64 0.53
65 0.49
66 0.49
67 0.53
68 0.56
69 0.57
70 0.63
71 0.7
72 0.66
73 0.66
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.68
80 0.74
81 0.81
82 0.84
83 0.85
84 0.84
85 0.85
86 0.86
87 0.82
88 0.77
89 0.78
90 0.77
91 0.77
92 0.78
93 0.78
94 0.78
95 0.84
96 0.88
97 0.86
98 0.86
99 0.87
100 0.87
101 0.85
102 0.76
103 0.76
104 0.75
105 0.71