Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WAJ0

Protein Details
Accession G0WAJ0   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-63TYNNEKTKDKVKRDILKRLYRRFIRHydrophilic
212-236ITTNDDTKKKSEKKKSAITNKLDLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
KEGG ndi:NDAI_0D04880  -  
Amino Acid Sequences MYGDKTIVTKNAITNSIYSLIRDKTKYLLWTDVKQIINTYNNEKTKDKVKRDILKRLYRRFIRVNVFVSNTKMVKDTYKDYVRYKFIKEDYHLKESIISSLDNPKSIASDSIPSEIETIVKSFEFVIKAISYIPEDSSKGCTYDIARDNTICRQILKNILTIEHEKMKQLIPQSIPWNDEKIRVSTPYLDYRIQFNHLKKVMKYRNNNDKGITTNDDTKKKSEKKKSAITNKLDLQLQAIGEFDKCLIYLNKSLGTRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.29
4 0.26
5 0.23
6 0.24
7 0.25
8 0.3
9 0.3
10 0.29
11 0.28
12 0.32
13 0.35
14 0.34
15 0.39
16 0.38
17 0.4
18 0.44
19 0.48
20 0.44
21 0.41
22 0.39
23 0.35
24 0.36
25 0.35
26 0.36
27 0.37
28 0.4
29 0.44
30 0.43
31 0.41
32 0.46
33 0.53
34 0.54
35 0.55
36 0.61
37 0.67
38 0.73
39 0.81
40 0.81
41 0.81
42 0.83
43 0.82
44 0.82
45 0.77
46 0.76
47 0.72
48 0.7
49 0.66
50 0.62
51 0.56
52 0.5
53 0.49
54 0.44
55 0.4
56 0.36
57 0.3
58 0.25
59 0.23
60 0.2
61 0.2
62 0.22
63 0.23
64 0.27
65 0.32
66 0.35
67 0.38
68 0.43
69 0.46
70 0.46
71 0.45
72 0.43
73 0.41
74 0.42
75 0.41
76 0.45
77 0.45
78 0.47
79 0.44
80 0.38
81 0.36
82 0.31
83 0.3
84 0.21
85 0.15
86 0.12
87 0.19
88 0.2
89 0.18
90 0.18
91 0.16
92 0.16
93 0.16
94 0.15
95 0.09
96 0.11
97 0.11
98 0.13
99 0.13
100 0.12
101 0.12
102 0.11
103 0.11
104 0.08
105 0.08
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.08
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.08
121 0.08
122 0.08
123 0.09
124 0.12
125 0.12
126 0.12
127 0.12
128 0.12
129 0.12
130 0.19
131 0.24
132 0.23
133 0.23
134 0.23
135 0.25
136 0.26
137 0.29
138 0.22
139 0.18
140 0.17
141 0.19
142 0.25
143 0.25
144 0.25
145 0.22
146 0.22
147 0.24
148 0.24
149 0.25
150 0.23
151 0.22
152 0.2
153 0.21
154 0.21
155 0.21
156 0.21
157 0.23
158 0.2
159 0.24
160 0.29
161 0.3
162 0.31
163 0.3
164 0.32
165 0.27
166 0.3
167 0.28
168 0.26
169 0.26
170 0.25
171 0.26
172 0.25
173 0.28
174 0.29
175 0.31
176 0.3
177 0.29
178 0.31
179 0.31
180 0.32
181 0.35
182 0.31
183 0.37
184 0.4
185 0.43
186 0.42
187 0.51
188 0.56
189 0.59
190 0.66
191 0.67
192 0.73
193 0.75
194 0.76
195 0.67
196 0.6
197 0.54
198 0.5
199 0.45
200 0.37
201 0.4
202 0.44
203 0.48
204 0.48
205 0.49
206 0.54
207 0.59
208 0.66
209 0.68
210 0.71
211 0.74
212 0.82
213 0.87
214 0.88
215 0.88
216 0.84
217 0.81
218 0.75
219 0.71
220 0.63
221 0.52
222 0.43
223 0.36
224 0.3
225 0.22
226 0.17
227 0.14
228 0.12
229 0.12
230 0.1
231 0.08
232 0.07
233 0.11
234 0.13
235 0.17
236 0.21
237 0.24
238 0.29