Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H7Y9

Protein Details
Accession A0A165H7Y9   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-87PPPAQKQDSRSRHKARQVRRBasic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto_nucl 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF02338  OTU  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22748  OTU_OTUD6-like  
Amino Acid Sequences MAGSKRNRFKKAFSLKAPASAPATPPEPAVDDDDNLVDDLLAELDSRDKAVPPAVHSDTAVDKIAETPPPAQKQDSRSRHKARQVRRLAALVVHSVPDLIIHARIQARRAAALAEQYAPSNPEADARLQKEAQEEEKTIKRICDELGLEMYEITPDGHCLFSAVADQLATLKILPAGQATYTTCRHAAADYIHNHPDDFLPFLPSVDGEDAAGATSDTGLMTPAEFDRYCATMRDTGAWGGEPEILALSSAFNVPIHVIQCGQPPIVIHQPQGSTENSSVSDKNVVHISYHRRMYGLGEHYNSLRPKFSFKGTVKSVFKPNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.67
3 0.69
4 0.64
5 0.56
6 0.49
7 0.41
8 0.36
9 0.3
10 0.31
11 0.24
12 0.24
13 0.22
14 0.2
15 0.2
16 0.24
17 0.21
18 0.19
19 0.2
20 0.2
21 0.19
22 0.16
23 0.15
24 0.09
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.07
32 0.07
33 0.09
34 0.09
35 0.1
36 0.11
37 0.17
38 0.19
39 0.19
40 0.27
41 0.28
42 0.28
43 0.28
44 0.28
45 0.25
46 0.25
47 0.23
48 0.15
49 0.13
50 0.14
51 0.16
52 0.16
53 0.16
54 0.18
55 0.24
56 0.29
57 0.31
58 0.33
59 0.36
60 0.42
61 0.51
62 0.57
63 0.59
64 0.64
65 0.7
66 0.75
67 0.8
68 0.8
69 0.79
70 0.8
71 0.8
72 0.76
73 0.7
74 0.64
75 0.55
76 0.49
77 0.4
78 0.32
79 0.23
80 0.17
81 0.13
82 0.11
83 0.1
84 0.08
85 0.08
86 0.06
87 0.06
88 0.06
89 0.1
90 0.13
91 0.15
92 0.16
93 0.18
94 0.18
95 0.17
96 0.18
97 0.15
98 0.12
99 0.14
100 0.13
101 0.11
102 0.11
103 0.11
104 0.11
105 0.11
106 0.11
107 0.09
108 0.08
109 0.09
110 0.1
111 0.12
112 0.17
113 0.18
114 0.21
115 0.2
116 0.22
117 0.22
118 0.23
119 0.23
120 0.21
121 0.2
122 0.21
123 0.25
124 0.26
125 0.24
126 0.23
127 0.2
128 0.19
129 0.19
130 0.19
131 0.15
132 0.14
133 0.14
134 0.14
135 0.13
136 0.12
137 0.11
138 0.06
139 0.06
140 0.05
141 0.04
142 0.04
143 0.05
144 0.05
145 0.05
146 0.06
147 0.05
148 0.05
149 0.06
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.05
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.04
163 0.05
164 0.05
165 0.06
166 0.07
167 0.11
168 0.12
169 0.13
170 0.13
171 0.13
172 0.13
173 0.12
174 0.14
175 0.13
176 0.18
177 0.2
178 0.23
179 0.24
180 0.24
181 0.24
182 0.22
183 0.2
184 0.14
185 0.14
186 0.11
187 0.11
188 0.11
189 0.11
190 0.11
191 0.1
192 0.1
193 0.09
194 0.09
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.04
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.04
207 0.04
208 0.04
209 0.05
210 0.05
211 0.09
212 0.09
213 0.1
214 0.12
215 0.13
216 0.14
217 0.15
218 0.17
219 0.17
220 0.18
221 0.19
222 0.19
223 0.18
224 0.18
225 0.17
226 0.14
227 0.12
228 0.11
229 0.08
230 0.07
231 0.07
232 0.06
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.06
239 0.05
240 0.06
241 0.07
242 0.09
243 0.1
244 0.1
245 0.11
246 0.12
247 0.17
248 0.18
249 0.17
250 0.16
251 0.16
252 0.2
253 0.28
254 0.28
255 0.24
256 0.26
257 0.27
258 0.28
259 0.3
260 0.27
261 0.23
262 0.22
263 0.23
264 0.21
265 0.23
266 0.22
267 0.21
268 0.26
269 0.21
270 0.23
271 0.25
272 0.23
273 0.22
274 0.28
275 0.35
276 0.37
277 0.41
278 0.39
279 0.35
280 0.35
281 0.37
282 0.39
283 0.37
284 0.36
285 0.34
286 0.35
287 0.36
288 0.43
289 0.42
290 0.36
291 0.34
292 0.3
293 0.34
294 0.37
295 0.41
296 0.45
297 0.45
298 0.52
299 0.53
300 0.62
301 0.6
302 0.62