Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165E9B9

Protein Details
Accession A0A165E9B9   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
243-266EVATTKKKVTSRSHKRKVDDGDTKHydrophilic
NLS Segment(s)
PositionSequence
192-216PKAKGKKKSASNGAASKKRKGPGKA
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002740  EVE_domain  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01878  EVE  
CDD cd21133  EVE  
Amino Acid Sequences MSAKFWLMKAEPDSRIVKGKDVKFSVDDFESVKTTPWEGVRNAEARNLMKEMKAGDRVLFYHSNCKNPGIAAFAMVTKEAYPDYTAWDPTHPYYDAKTDKADPKWYMVDVTFVSRAAHFVPLSLLRNIAAAPPDAPPSGVEYIGSDGVKAIKEMVLVTRGRLSVQRVEEKTWGVLEDLAEKGGWEEAGVSAPKAKGKKKSASNGAASKKRKGPGKATKDETKDDEPSVTAEGGPPATQDVSDEVATTKKKVTSRSHKRKVDDGDTKPDEALVRRSTRLRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.4
4 0.42
5 0.44
6 0.47
7 0.5
8 0.5
9 0.51
10 0.45
11 0.46
12 0.43
13 0.35
14 0.31
15 0.24
16 0.24
17 0.22
18 0.2
19 0.2
20 0.16
21 0.16
22 0.18
23 0.2
24 0.22
25 0.22
26 0.26
27 0.29
28 0.31
29 0.31
30 0.31
31 0.32
32 0.29
33 0.31
34 0.29
35 0.25
36 0.22
37 0.23
38 0.23
39 0.23
40 0.26
41 0.24
42 0.22
43 0.23
44 0.23
45 0.26
46 0.28
47 0.24
48 0.3
49 0.32
50 0.36
51 0.36
52 0.36
53 0.32
54 0.28
55 0.28
56 0.22
57 0.2
58 0.15
59 0.14
60 0.14
61 0.13
62 0.12
63 0.12
64 0.07
65 0.08
66 0.07
67 0.07
68 0.08
69 0.08
70 0.12
71 0.14
72 0.16
73 0.16
74 0.17
75 0.18
76 0.18
77 0.21
78 0.18
79 0.17
80 0.17
81 0.23
82 0.25
83 0.24
84 0.26
85 0.28
86 0.33
87 0.35
88 0.39
89 0.33
90 0.33
91 0.33
92 0.31
93 0.27
94 0.21
95 0.2
96 0.14
97 0.16
98 0.13
99 0.11
100 0.12
101 0.1
102 0.11
103 0.09
104 0.11
105 0.08
106 0.08
107 0.09
108 0.12
109 0.14
110 0.13
111 0.12
112 0.1
113 0.11
114 0.1
115 0.1
116 0.08
117 0.06
118 0.07
119 0.07
120 0.09
121 0.08
122 0.08
123 0.08
124 0.1
125 0.11
126 0.1
127 0.09
128 0.08
129 0.09
130 0.1
131 0.1
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.06
138 0.05
139 0.05
140 0.06
141 0.06
142 0.09
143 0.09
144 0.1
145 0.12
146 0.11
147 0.12
148 0.14
149 0.16
150 0.17
151 0.21
152 0.28
153 0.27
154 0.3
155 0.31
156 0.3
157 0.27
158 0.22
159 0.19
160 0.12
161 0.11
162 0.09
163 0.09
164 0.09
165 0.08
166 0.08
167 0.07
168 0.07
169 0.07
170 0.06
171 0.04
172 0.04
173 0.04
174 0.06
175 0.07
176 0.06
177 0.09
178 0.1
179 0.14
180 0.18
181 0.23
182 0.31
183 0.38
184 0.47
185 0.53
186 0.62
187 0.67
188 0.69
189 0.7
190 0.7
191 0.7
192 0.71
193 0.65
194 0.63
195 0.59
196 0.58
197 0.59
198 0.56
199 0.59
200 0.61
201 0.68
202 0.7
203 0.71
204 0.74
205 0.71
206 0.69
207 0.64
208 0.59
209 0.52
210 0.44
211 0.38
212 0.3
213 0.27
214 0.25
215 0.19
216 0.14
217 0.11
218 0.12
219 0.11
220 0.11
221 0.09
222 0.09
223 0.09
224 0.09
225 0.09
226 0.1
227 0.12
228 0.12
229 0.13
230 0.12
231 0.17
232 0.18
233 0.19
234 0.21
235 0.23
236 0.27
237 0.35
238 0.45
239 0.52
240 0.62
241 0.72
242 0.79
243 0.81
244 0.83
245 0.83
246 0.81
247 0.8
248 0.79
249 0.73
250 0.73
251 0.69
252 0.65
253 0.56
254 0.49
255 0.42
256 0.35
257 0.36
258 0.33
259 0.34
260 0.37
261 0.45