Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165G371

Protein Details
Accession A0A165G371    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-33KNVNRNGKGKPRKSNTPFQRVKHydrophilic
69-94VTRGAGFRKEKNKKKRGSYRGGDITMHydrophilic
NLS Segment(s)
PositionSequence
19-23KGKPR
74-85GFRKEKNKKKRG
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences PGNNGNGNTNGKNVNRNGKGKPRKSNTPFQRVKADGAKFDDVRLQDNRYEARGAGANDYGERAARDLIVTRGAGFRKEKNKKKRGSYRGGDITMQSYSIKFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.51
4 0.55
5 0.6
6 0.69
7 0.71
8 0.76
9 0.73
10 0.77
11 0.78
12 0.82
13 0.8
14 0.8
15 0.77
16 0.71
17 0.71
18 0.62
19 0.6
20 0.57
21 0.49
22 0.42
23 0.4
24 0.4
25 0.32
26 0.3
27 0.29
28 0.22
29 0.24
30 0.22
31 0.2
32 0.17
33 0.19
34 0.2
35 0.18
36 0.18
37 0.14
38 0.13
39 0.14
40 0.13
41 0.12
42 0.12
43 0.1
44 0.1
45 0.1
46 0.09
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.08
55 0.1
56 0.09
57 0.1
58 0.13
59 0.14
60 0.17
61 0.19
62 0.25
63 0.35
64 0.45
65 0.55
66 0.62
67 0.71
68 0.76
69 0.84
70 0.88
71 0.87
72 0.87
73 0.84
74 0.83
75 0.82
76 0.75
77 0.66
78 0.56
79 0.49
80 0.39
81 0.33
82 0.23