Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165G2Z8

Protein Details
Accession A0A165G2Z8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25GLRSCSWMRYCRRRPGLRRYIHQWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MGLRSCSWMRYCRRRPGLRRYIHQWEATCTHRRPHIRSLRLLAAHGRALGNSLTSLICIIFKVTYHPGASLPFSCYWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.86
4 0.87
5 0.84
6 0.82
7 0.79
8 0.78
9 0.72
10 0.68
11 0.57
12 0.51
13 0.47
14 0.44
15 0.43
16 0.36
17 0.34
18 0.37
19 0.41
20 0.41
21 0.48
22 0.53
23 0.51
24 0.52
25 0.53
26 0.5
27 0.46
28 0.42
29 0.33
30 0.25
31 0.21
32 0.18
33 0.14
34 0.1
35 0.1
36 0.1
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.05
44 0.06
45 0.05
46 0.06
47 0.06
48 0.06
49 0.11
50 0.14
51 0.17
52 0.18
53 0.19
54 0.19
55 0.21
56 0.24
57 0.21
58 0.22