Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H2I3

Protein Details
Accession A0A165H2I3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-110DVEAKKKRGKGVPKKAKSKADSRRTQRKRBasic
NLS Segment(s)
PositionSequence
85-110AKKKRGKGVPKKAKSKADSRRTQRKR
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MATAAPVNPSRLATLTRLRCAIFQTSYNPTSIRTGAKYLRARLRGPSMVQYYPKPFTVAMFNRMHGGEFKIVDEKEERRVADVEAKKKRGKGVPKKAKSKADSRRTQRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.34
4 0.36
5 0.35
6 0.34
7 0.35
8 0.35
9 0.28
10 0.25
11 0.26
12 0.3
13 0.31
14 0.3
15 0.28
16 0.24
17 0.24
18 0.24
19 0.22
20 0.18
21 0.22
22 0.23
23 0.32
24 0.34
25 0.38
26 0.43
27 0.44
28 0.43
29 0.42
30 0.45
31 0.39
32 0.36
33 0.36
34 0.32
35 0.3
36 0.31
37 0.3
38 0.28
39 0.27
40 0.26
41 0.21
42 0.17
43 0.16
44 0.22
45 0.21
46 0.24
47 0.24
48 0.24
49 0.24
50 0.24
51 0.24
52 0.17
53 0.17
54 0.12
55 0.12
56 0.12
57 0.15
58 0.14
59 0.15
60 0.18
61 0.18
62 0.22
63 0.25
64 0.24
65 0.23
66 0.24
67 0.24
68 0.3
69 0.35
70 0.38
71 0.43
72 0.49
73 0.5
74 0.52
75 0.58
76 0.57
77 0.61
78 0.63
79 0.66
80 0.72
81 0.78
82 0.86
83 0.87
84 0.89
85 0.83
86 0.82
87 0.82
88 0.81
89 0.82
90 0.82