Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165E2Q1

Protein Details
Accession A0A165E2Q1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
52-79NSHLHNKKLPTQKKVRNKKVLRLSRTHCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 4, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MDKDNRDDVTFAKLSDLKLLITFCISQLEGTGKLRSYTELLENQSCVCTTWNSHLHNKKLPTQKKVRNKKVLRLSRTHCRFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.24
4 0.17
5 0.18
6 0.19
7 0.15
8 0.14
9 0.14
10 0.1
11 0.11
12 0.11
13 0.09
14 0.09
15 0.11
16 0.11
17 0.13
18 0.14
19 0.12
20 0.13
21 0.13
22 0.13
23 0.12
24 0.12
25 0.13
26 0.15
27 0.17
28 0.17
29 0.17
30 0.16
31 0.15
32 0.14
33 0.11
34 0.09
35 0.08
36 0.08
37 0.15
38 0.21
39 0.25
40 0.34
41 0.4
42 0.45
43 0.5
44 0.52
45 0.54
46 0.58
47 0.62
48 0.62
49 0.66
50 0.71
51 0.75
52 0.83
53 0.86
54 0.86
55 0.86
56 0.87
57 0.87
58 0.87
59 0.84
60 0.82
61 0.79
62 0.79