Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165BW08

Protein Details
Accession A0A165BW08    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-96NVSPKPHVLKNVKRTWRRSHWRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR022782  AIP3-like_C  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF03915  AIP3  
Amino Acid Sequences MRQMYTEFVKQTKESLGALRSQTHNVRQLATQKVGGASINDRKATVDLQSPNGQTKTEELQDIVESIKGDVTKRNVSPKPHVLKNVKRTWRRSHWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.25
5 0.26
6 0.28
7 0.27
8 0.3
9 0.33
10 0.34
11 0.39
12 0.36
13 0.35
14 0.34
15 0.38
16 0.38
17 0.35
18 0.31
19 0.24
20 0.24
21 0.23
22 0.2
23 0.14
24 0.13
25 0.17
26 0.19
27 0.18
28 0.18
29 0.18
30 0.19
31 0.18
32 0.16
33 0.15
34 0.14
35 0.17
36 0.2
37 0.2
38 0.22
39 0.22
40 0.2
41 0.16
42 0.17
43 0.17
44 0.15
45 0.15
46 0.13
47 0.13
48 0.13
49 0.13
50 0.11
51 0.09
52 0.08
53 0.07
54 0.09
55 0.09
56 0.09
57 0.14
58 0.18
59 0.23
60 0.26
61 0.35
62 0.39
63 0.44
64 0.52
65 0.57
66 0.6
67 0.61
68 0.67
69 0.68
70 0.72
71 0.77
72 0.79
73 0.79
74 0.8
75 0.81
76 0.82