Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165FE62

Protein Details
Accession A0A165FE62    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTPKHTSKKARKWLEEHGFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MTPKHTSKKARKWLEEHGFETMVWPAQSPDLNPIEHLWHHLKRKLAAYENAPGGIAELWERYARQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.68
4 0.6
5 0.51
6 0.43
7 0.38
8 0.28
9 0.19
10 0.13
11 0.11
12 0.08
13 0.09
14 0.1
15 0.09
16 0.13
17 0.13
18 0.13
19 0.14
20 0.14
21 0.14
22 0.14
23 0.18
24 0.18
25 0.22
26 0.27
27 0.29
28 0.32
29 0.33
30 0.39
31 0.41
32 0.41
33 0.4
34 0.39
35 0.41
36 0.39
37 0.36
38 0.3
39 0.24
40 0.2
41 0.16
42 0.12
43 0.08
44 0.07
45 0.09
46 0.1