Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165CYE3

Protein Details
Accession A0A165CYE3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-26FSAKPTQRKHLPCPRTSRRPSSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MHAFSAKPTQRKHLPCPRTSRRPSSVDLSTIRAQPIPLSTTECTSEARAGELSRCSESPVHGIVALSLMTGCGGVRLVGVARCAVAWGVFHIRVLRRGLYSRRLRVSPLSIMKYTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.79
4 0.8
5 0.82
6 0.82
7 0.81
8 0.77
9 0.73
10 0.69
11 0.65
12 0.58
13 0.52
14 0.46
15 0.42
16 0.38
17 0.35
18 0.32
19 0.26
20 0.23
21 0.19
22 0.19
23 0.15
24 0.13
25 0.15
26 0.15
27 0.16
28 0.18
29 0.18
30 0.17
31 0.16
32 0.17
33 0.13
34 0.13
35 0.12
36 0.11
37 0.11
38 0.12
39 0.12
40 0.12
41 0.12
42 0.13
43 0.12
44 0.13
45 0.13
46 0.12
47 0.11
48 0.1
49 0.1
50 0.08
51 0.08
52 0.07
53 0.05
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.07
75 0.11
76 0.11
77 0.12
78 0.16
79 0.18
80 0.22
81 0.25
82 0.24
83 0.23
84 0.3
85 0.35
86 0.41
87 0.49
88 0.52
89 0.56
90 0.55
91 0.55
92 0.55
93 0.55
94 0.54
95 0.53
96 0.5