Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165BMQ4

Protein Details
Accession A0A165BMQ4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-93ILTARKDARNWRKRAKFWKGKAKKDTSSHydrophilic
NLS Segment(s)
PositionSequence
71-89KDARNWRKRAKFWKGKAKK
Subcellular Location(s) cyto 12, nucl 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MIAVGAHKPVLAQAYSALDQGAEPEAALVTAIKEAVSNPDSVWAALLEPVIGPRTPADYEAQIRCILTARKDARNWRKRAKFWKGKAKKDTSSADLVTPSPSDISSIVEELPDARKRALKELI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.15
5 0.12
6 0.11
7 0.12
8 0.11
9 0.07
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.09
23 0.1
24 0.1
25 0.1
26 0.13
27 0.14
28 0.13
29 0.13
30 0.09
31 0.08
32 0.08
33 0.08
34 0.05
35 0.04
36 0.05
37 0.06
38 0.05
39 0.06
40 0.05
41 0.08
42 0.08
43 0.09
44 0.1
45 0.11
46 0.15
47 0.16
48 0.17
49 0.15
50 0.14
51 0.13
52 0.14
53 0.13
54 0.11
55 0.19
56 0.22
57 0.27
58 0.31
59 0.41
60 0.5
61 0.58
62 0.64
63 0.66
64 0.7
65 0.73
66 0.8
67 0.81
68 0.8
69 0.8
70 0.84
71 0.84
72 0.85
73 0.87
74 0.84
75 0.77
76 0.74
77 0.69
78 0.62
79 0.57
80 0.48
81 0.4
82 0.33
83 0.29
84 0.24
85 0.19
86 0.16
87 0.12
88 0.1
89 0.11
90 0.1
91 0.12
92 0.12
93 0.13
94 0.12
95 0.11
96 0.11
97 0.12
98 0.18
99 0.19
100 0.2
101 0.22
102 0.26
103 0.29