Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H9T1

Protein Details
Accession A0A165H9T1   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
339-366KAEHAAKEKLRRERREQQERNIQRKKKLBasic
NLS Segment(s)
PositionSequence
339-366KAEHAAKEKLRRERREQQERNIQRKKKL
438-448PLPKKPRQGKR
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR045112  PPAN-like  
Gene Ontology GO:0016020  C:membrane  
GO:0019843  F:rRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MARRRKNRTHLKGGVASNPGSAEGVPRSFVIKHGQVGTSLTQLVRDVRKVMEPNTASRLKERTRNKLKDFFTMAPALGVTHLLAFTLTDVAPSLRIVRLSAGPTLSFRVERYSLIKDMLNSSRRARSMSSTDYLNPPLLVLASFPQPGPTTPPHLSLLMKTFQTLFPPLSPQKIALSSARRVVLISYNADRGTIDFRHYLITVKPYGISKRVRRVLEGASSKAASSSKTYLDLGNEKDVADFFLRRKGEPGPGASDGYESAASSASSAAGDDADVVSLADDYVGRNNKKGEKRAVRLDEVGPRMELRLVKITEGLPGKEGAVIYHEFVKKTKAQAASQKAEHAAKEKLRRERREQQERNIQRKKKLVGGKDAETGSGEDNGEEEQEDGADGSELSGGDEEHEDEGAWDDEEEYNGSEEDGDESAEDSDSETDADVPRPLPKKPRQGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.65
3 0.55
4 0.46
5 0.38
6 0.3
7 0.23
8 0.19
9 0.16
10 0.16
11 0.16
12 0.16
13 0.16
14 0.18
15 0.18
16 0.21
17 0.25
18 0.25
19 0.28
20 0.31
21 0.31
22 0.29
23 0.32
24 0.3
25 0.25
26 0.23
27 0.19
28 0.16
29 0.17
30 0.22
31 0.23
32 0.24
33 0.24
34 0.24
35 0.31
36 0.34
37 0.34
38 0.38
39 0.36
40 0.38
41 0.43
42 0.45
43 0.4
44 0.41
45 0.47
46 0.43
47 0.5
48 0.54
49 0.58
50 0.65
51 0.74
52 0.77
53 0.78
54 0.75
55 0.75
56 0.73
57 0.64
58 0.57
59 0.49
60 0.41
61 0.32
62 0.29
63 0.21
64 0.15
65 0.12
66 0.08
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.07
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.09
80 0.1
81 0.09
82 0.1
83 0.1
84 0.12
85 0.15
86 0.16
87 0.18
88 0.17
89 0.16
90 0.17
91 0.19
92 0.19
93 0.16
94 0.15
95 0.18
96 0.18
97 0.19
98 0.22
99 0.24
100 0.24
101 0.25
102 0.26
103 0.22
104 0.26
105 0.31
106 0.31
107 0.3
108 0.32
109 0.36
110 0.35
111 0.36
112 0.33
113 0.31
114 0.34
115 0.36
116 0.34
117 0.3
118 0.32
119 0.32
120 0.32
121 0.27
122 0.21
123 0.16
124 0.14
125 0.12
126 0.09
127 0.07
128 0.07
129 0.08
130 0.09
131 0.09
132 0.11
133 0.11
134 0.11
135 0.16
136 0.17
137 0.22
138 0.22
139 0.26
140 0.26
141 0.27
142 0.27
143 0.24
144 0.25
145 0.21
146 0.2
147 0.17
148 0.17
149 0.15
150 0.17
151 0.17
152 0.14
153 0.12
154 0.19
155 0.19
156 0.21
157 0.21
158 0.2
159 0.2
160 0.2
161 0.21
162 0.2
163 0.23
164 0.22
165 0.26
166 0.25
167 0.23
168 0.22
169 0.21
170 0.19
171 0.17
172 0.18
173 0.15
174 0.17
175 0.16
176 0.16
177 0.15
178 0.12
179 0.14
180 0.13
181 0.13
182 0.12
183 0.13
184 0.14
185 0.15
186 0.15
187 0.12
188 0.15
189 0.14
190 0.13
191 0.14
192 0.14
193 0.16
194 0.21
195 0.27
196 0.29
197 0.37
198 0.44
199 0.43
200 0.42
201 0.44
202 0.41
203 0.41
204 0.38
205 0.3
206 0.25
207 0.24
208 0.22
209 0.2
210 0.17
211 0.11
212 0.11
213 0.12
214 0.11
215 0.13
216 0.14
217 0.13
218 0.15
219 0.17
220 0.16
221 0.16
222 0.16
223 0.14
224 0.14
225 0.13
226 0.12
227 0.1
228 0.1
229 0.09
230 0.15
231 0.16
232 0.16
233 0.18
234 0.19
235 0.23
236 0.23
237 0.25
238 0.22
239 0.23
240 0.23
241 0.21
242 0.19
243 0.15
244 0.13
245 0.11
246 0.07
247 0.06
248 0.06
249 0.06
250 0.05
251 0.05
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.04
269 0.09
270 0.15
271 0.16
272 0.18
273 0.22
274 0.3
275 0.36
276 0.43
277 0.48
278 0.52
279 0.57
280 0.64
281 0.66
282 0.6
283 0.57
284 0.54
285 0.5
286 0.42
287 0.37
288 0.28
289 0.24
290 0.21
291 0.21
292 0.18
293 0.14
294 0.19
295 0.19
296 0.19
297 0.2
298 0.2
299 0.23
300 0.24
301 0.22
302 0.16
303 0.16
304 0.16
305 0.15
306 0.15
307 0.09
308 0.1
309 0.11
310 0.11
311 0.17
312 0.19
313 0.18
314 0.19
315 0.23
316 0.23
317 0.26
318 0.32
319 0.3
320 0.34
321 0.42
322 0.5
323 0.52
324 0.5
325 0.49
326 0.46
327 0.43
328 0.39
329 0.34
330 0.32
331 0.33
332 0.41
333 0.46
334 0.52
335 0.6
336 0.67
337 0.72
338 0.76
339 0.8
340 0.83
341 0.83
342 0.82
343 0.83
344 0.86
345 0.88
346 0.87
347 0.83
348 0.79
349 0.79
350 0.74
351 0.71
352 0.69
353 0.65
354 0.65
355 0.65
356 0.61
357 0.58
358 0.54
359 0.46
360 0.39
361 0.33
362 0.24
363 0.2
364 0.17
365 0.11
366 0.11
367 0.11
368 0.1
369 0.09
370 0.09
371 0.06
372 0.06
373 0.06
374 0.06
375 0.06
376 0.06
377 0.05
378 0.05
379 0.06
380 0.06
381 0.06
382 0.07
383 0.06
384 0.07
385 0.08
386 0.09
387 0.09
388 0.09
389 0.09
390 0.09
391 0.11
392 0.11
393 0.1
394 0.09
395 0.1
396 0.1
397 0.11
398 0.12
399 0.1
400 0.11
401 0.1
402 0.1
403 0.09
404 0.09
405 0.1
406 0.1
407 0.09
408 0.08
409 0.09
410 0.09
411 0.09
412 0.09
413 0.08
414 0.09
415 0.09
416 0.09
417 0.09
418 0.1
419 0.12
420 0.14
421 0.15
422 0.15
423 0.23
424 0.26
425 0.31
426 0.4
427 0.47
428 0.57