Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H070

Protein Details
Accession A0A165H070   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
27-69GQEYQPSQRKRKRRHGFLARMRSRSGRKILARRRAKGRRFLSHBasic
NLS Segment(s)
PositionSequence
35-66RKRKRRHGFLARMRSRSGRKILARRRAKGRRF
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MRPLTAALSTPSPVLSVLQQTRHTTYGQEYQPSQRKRKRRHGFLARMRSRSGRKILARRRAKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.16
4 0.18
5 0.22
6 0.26
7 0.28
8 0.31
9 0.31
10 0.3
11 0.24
12 0.25
13 0.28
14 0.26
15 0.26
16 0.24
17 0.31
18 0.39
19 0.43
20 0.49
21 0.49
22 0.57
23 0.64
24 0.74
25 0.76
26 0.78
27 0.82
28 0.84
29 0.88
30 0.88
31 0.9
32 0.85
33 0.78
34 0.7
35 0.66
36 0.6
37 0.56
38 0.52
39 0.5
40 0.52
41 0.6
42 0.67
43 0.71
44 0.76
45 0.77
46 0.82
47 0.83
48 0.82
49 0.82