Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165B7E4

Protein Details
Accession A0A165B7E4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
84-105ILSPLCTKRRRKLTYFLKYRPNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, nucl 6.5, cyto_nucl 6, cyto 4.5, pero 2, plas 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MGLVLSLLFPFWWRIWVVSADTVPVADEKFGSTDSFISSDNDGGICLVNDLSKSSLSISLDCLFGEPESSSLPPSAVLPEDPSILSPLCTKRRRKLTYFLKYRPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.19
5 0.19
6 0.18
7 0.17
8 0.16
9 0.15
10 0.13
11 0.11
12 0.09
13 0.06
14 0.06
15 0.06
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.09
22 0.1
23 0.1
24 0.11
25 0.1
26 0.1
27 0.1
28 0.09
29 0.08
30 0.07
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.08
43 0.09
44 0.09
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.09
51 0.08
52 0.09
53 0.06
54 0.06
55 0.07
56 0.08
57 0.08
58 0.08
59 0.09
60 0.08
61 0.08
62 0.09
63 0.08
64 0.09
65 0.1
66 0.11
67 0.12
68 0.12
69 0.12
70 0.13
71 0.12
72 0.12
73 0.15
74 0.21
75 0.3
76 0.38
77 0.46
78 0.53
79 0.64
80 0.71
81 0.73
82 0.76
83 0.77
84 0.81
85 0.83