Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165EPN5

Protein Details
Accession A0A165EPN5    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRLRRSRTHHAKRDVHRAARTBasic
75-94LRSHWRGKVHKRRCKTLREPBasic
NLS Segment(s)
PositionSequence
12-14AKR
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHHAKRDVHRAARTRARTRDLDQIQLIDLDPKNRAILEAQPLDPEKPGLAQHYCVECAKYFETDAALRSHWRGKVHKRRCKTLREPAYTIEESERAAGLGREGKRMTTTTTSLRSPMQETSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.82
4 0.79
5 0.76
6 0.74
7 0.74
8 0.75
9 0.73
10 0.71
11 0.69
12 0.66
13 0.62
14 0.64
15 0.57
16 0.54
17 0.46
18 0.39
19 0.34
20 0.29
21 0.26
22 0.2
23 0.18
24 0.15
25 0.15
26 0.15
27 0.15
28 0.14
29 0.14
30 0.11
31 0.13
32 0.18
33 0.19
34 0.19
35 0.2
36 0.21
37 0.21
38 0.2
39 0.17
40 0.11
41 0.09
42 0.1
43 0.11
44 0.11
45 0.12
46 0.15
47 0.16
48 0.17
49 0.16
50 0.16
51 0.13
52 0.14
53 0.14
54 0.12
55 0.11
56 0.09
57 0.11
58 0.1
59 0.12
60 0.1
61 0.1
62 0.1
63 0.12
64 0.16
65 0.17
66 0.22
67 0.28
68 0.38
69 0.48
70 0.59
71 0.66
72 0.68
73 0.76
74 0.78
75 0.81
76 0.79
77 0.79
78 0.78
79 0.77
80 0.73
81 0.65
82 0.66
83 0.56
84 0.48
85 0.39
86 0.29
87 0.22
88 0.2
89 0.17
90 0.1
91 0.1
92 0.09
93 0.09
94 0.16
95 0.16
96 0.21
97 0.21
98 0.22
99 0.24
100 0.26
101 0.28
102 0.26
103 0.29
104 0.3
105 0.35
106 0.35
107 0.35
108 0.36
109 0.34
110 0.32