Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BNM1

Protein Details
Accession A0A165BNM1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-53SRTPNKHAMHRRRQKLVRVCPIRRCTRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MQLIPFTPDAVHESQEGARGEIQTVSRTPNKHAMHRRRQKLVRVCPIRRCTRSPSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.2
4 0.17
5 0.16
6 0.15
7 0.16
8 0.16
9 0.16
10 0.12
11 0.12
12 0.15
13 0.17
14 0.18
15 0.2
16 0.28
17 0.3
18 0.37
19 0.47
20 0.53
21 0.61
22 0.7
23 0.75
24 0.75
25 0.79
26 0.8
27 0.8
28 0.8
29 0.8
30 0.8
31 0.79
32 0.79
33 0.82
34 0.83
35 0.78
36 0.73