Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165HR58

Protein Details
Accession A0A165HR58    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-117GEFAHPPKAKKKIRGHGPAVQBasic
NLS Segment(s)
PositionSequence
102-128PPKAKKKIRGHGPAVQNGKRIRSRRHK
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MSSFLAPQLSSLVPRLCRTFVSKAALQPVPPMRGTISSPETFLKAIGRSAETKVTAEKWEDLWKVDGHQMKKAGIAVRDRRYILWCMEKFRQGQEPGEFAHPPKAKKKIRGHGPAVQNGKRIRSRRHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.26
4 0.27
5 0.32
6 0.33
7 0.34
8 0.37
9 0.37
10 0.37
11 0.42
12 0.41
13 0.35
14 0.36
15 0.36
16 0.32
17 0.3
18 0.28
19 0.22
20 0.23
21 0.24
22 0.23
23 0.23
24 0.21
25 0.22
26 0.22
27 0.22
28 0.2
29 0.19
30 0.16
31 0.12
32 0.12
33 0.12
34 0.13
35 0.14
36 0.15
37 0.17
38 0.15
39 0.15
40 0.15
41 0.15
42 0.15
43 0.15
44 0.14
45 0.13
46 0.17
47 0.17
48 0.17
49 0.17
50 0.16
51 0.16
52 0.19
53 0.22
54 0.18
55 0.21
56 0.22
57 0.2
58 0.21
59 0.22
60 0.2
61 0.19
62 0.26
63 0.3
64 0.33
65 0.36
66 0.36
67 0.34
68 0.35
69 0.34
70 0.3
71 0.32
72 0.29
73 0.32
74 0.35
75 0.38
76 0.36
77 0.37
78 0.41
79 0.34
80 0.37
81 0.34
82 0.32
83 0.3
84 0.32
85 0.3
86 0.23
87 0.31
88 0.3
89 0.31
90 0.37
91 0.46
92 0.5
93 0.59
94 0.69
95 0.69
96 0.76
97 0.82
98 0.81
99 0.79
100 0.79
101 0.77
102 0.75
103 0.68
104 0.65
105 0.58
106 0.59
107 0.59
108 0.59