Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ER23

Protein Details
Accession A0A165ER23    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
180-199PPTLAKKRRITRENRQRRESBasic
NLS Segment(s)
PositionSequence
162-197VRGFSPTRLKLRPREPPMPPTLAKKRRITRENRQRR
Subcellular Location(s) cyto 13.5, cyto_nucl 11, nucl 7.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPTVPSSCVPLASLADEGVRLVPAGLHLQEDTAGPTPDPDLDDLVLVPAESGNVVTSTHAPELPAAYGRKADAGLSVKPRLSLGNLALHSPSSIIGTPFDLSPRFEYPFPTPPCEPEIPLSMSASLPNIRCSAAAFSMPFIGGAIGSGAPSFSTLPRPRAGVRGFSPTRLKLRPREPPMPPTLAKKRRITRENRQRRESAPDAISESSVTPTRSPGFGRRTSDDTVVSDESLEGMEGGSNESKDGVSVVSKGADEELLIRPASSSRTTSEVTLSVQEGPKTPLDALEDPCSAPSESLAVASATANGSADETHAVPAIGAPAPESPRTSSLPEKDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.1
6 0.09
7 0.07
8 0.06
9 0.06
10 0.07
11 0.11
12 0.11
13 0.11
14 0.11
15 0.11
16 0.12
17 0.12
18 0.14
19 0.13
20 0.14
21 0.12
22 0.13
23 0.14
24 0.15
25 0.15
26 0.14
27 0.13
28 0.12
29 0.13
30 0.12
31 0.11
32 0.1
33 0.08
34 0.07
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.07
43 0.09
44 0.12
45 0.13
46 0.13
47 0.13
48 0.13
49 0.15
50 0.15
51 0.18
52 0.16
53 0.15
54 0.16
55 0.16
56 0.17
57 0.15
58 0.14
59 0.15
60 0.17
61 0.21
62 0.25
63 0.27
64 0.26
65 0.27
66 0.27
67 0.23
68 0.22
69 0.21
70 0.18
71 0.22
72 0.22
73 0.22
74 0.22
75 0.21
76 0.19
77 0.15
78 0.13
79 0.08
80 0.08
81 0.08
82 0.08
83 0.1
84 0.1
85 0.1
86 0.12
87 0.11
88 0.12
89 0.15
90 0.17
91 0.19
92 0.18
93 0.22
94 0.25
95 0.33
96 0.35
97 0.36
98 0.34
99 0.33
100 0.39
101 0.36
102 0.33
103 0.26
104 0.26
105 0.23
106 0.23
107 0.22
108 0.17
109 0.16
110 0.15
111 0.14
112 0.13
113 0.11
114 0.12
115 0.13
116 0.12
117 0.12
118 0.13
119 0.13
120 0.11
121 0.12
122 0.1
123 0.1
124 0.1
125 0.1
126 0.09
127 0.07
128 0.06
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.05
140 0.13
141 0.15
142 0.18
143 0.19
144 0.22
145 0.22
146 0.28
147 0.28
148 0.25
149 0.24
150 0.31
151 0.3
152 0.32
153 0.34
154 0.3
155 0.34
156 0.34
157 0.36
158 0.35
159 0.42
160 0.48
161 0.52
162 0.57
163 0.55
164 0.56
165 0.56
166 0.53
167 0.48
168 0.46
169 0.49
170 0.5
171 0.54
172 0.56
173 0.59
174 0.63
175 0.7
176 0.71
177 0.72
178 0.76
179 0.8
180 0.8
181 0.78
182 0.72
183 0.66
184 0.66
185 0.58
186 0.52
187 0.42
188 0.35
189 0.32
190 0.29
191 0.27
192 0.19
193 0.16
194 0.12
195 0.13
196 0.12
197 0.1
198 0.12
199 0.13
200 0.14
201 0.16
202 0.22
203 0.27
204 0.31
205 0.36
206 0.37
207 0.4
208 0.41
209 0.41
210 0.35
211 0.29
212 0.27
213 0.24
214 0.2
215 0.16
216 0.13
217 0.11
218 0.09
219 0.08
220 0.04
221 0.04
222 0.04
223 0.04
224 0.06
225 0.07
226 0.07
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.06
233 0.06
234 0.07
235 0.08
236 0.08
237 0.08
238 0.08
239 0.08
240 0.08
241 0.07
242 0.09
243 0.11
244 0.11
245 0.11
246 0.11
247 0.11
248 0.12
249 0.15
250 0.15
251 0.15
252 0.15
253 0.19
254 0.2
255 0.21
256 0.22
257 0.2
258 0.19
259 0.19
260 0.19
261 0.18
262 0.2
263 0.2
264 0.19
265 0.21
266 0.21
267 0.2
268 0.19
269 0.18
270 0.21
271 0.24
272 0.26
273 0.27
274 0.27
275 0.26
276 0.26
277 0.26
278 0.21
279 0.17
280 0.14
281 0.11
282 0.1
283 0.1
284 0.11
285 0.08
286 0.08
287 0.09
288 0.09
289 0.08
290 0.08
291 0.08
292 0.07
293 0.08
294 0.07
295 0.08
296 0.09
297 0.09
298 0.1
299 0.1
300 0.1
301 0.09
302 0.09
303 0.11
304 0.1
305 0.09
306 0.1
307 0.14
308 0.17
309 0.19
310 0.21
311 0.22
312 0.25
313 0.29
314 0.33
315 0.37
316 0.41