Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H1C6

Protein Details
Accession A0A165H1C6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-86VERYRRKRLAELKKREKARFBasic
NLS Segment(s)
PositionSequence
71-86RRKRLAELKKREKARF
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024253  Phosducin_thioredoxin-like_dom  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF02114  Phosducin  
Amino Acid Sequences MALNPNEDTEFNDALRKHGILPPKPPTPRTPSPPPAPTLEESLEGLSPEDLRALSEDAVDDESERIVERYRRKRLAELKKREKARFGRVYPIGREQYTDEVTEASKEQEEGKPEGHGTGVVCFLYKDGIPRSDRAFEHIRTLAARYPNTKFVSIVGEKCIPNLPEERIPMFIIYRNGEVINQLASWGADREKSIEELEAILTLAGAVVPELHPQRSDRENDRSDSDRDSEDEASDDEPSSRMRSAGTHTNRSTGKNIRTPAKDDSDSDFDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.25
4 0.22
5 0.25
6 0.33
7 0.34
8 0.42
9 0.47
10 0.53
11 0.58
12 0.59
13 0.62
14 0.61
15 0.65
16 0.65
17 0.67
18 0.67
19 0.7
20 0.71
21 0.66
22 0.62
23 0.58
24 0.51
25 0.46
26 0.39
27 0.32
28 0.28
29 0.26
30 0.22
31 0.17
32 0.16
33 0.11
34 0.1
35 0.08
36 0.09
37 0.07
38 0.07
39 0.09
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.11
46 0.1
47 0.09
48 0.08
49 0.07
50 0.07
51 0.08
52 0.07
53 0.1
54 0.17
55 0.26
56 0.36
57 0.45
58 0.52
59 0.55
60 0.63
61 0.7
62 0.75
63 0.76
64 0.77
65 0.78
66 0.79
67 0.85
68 0.79
69 0.77
70 0.73
71 0.73
72 0.71
73 0.63
74 0.63
75 0.61
76 0.62
77 0.56
78 0.56
79 0.49
80 0.39
81 0.38
82 0.31
83 0.29
84 0.26
85 0.24
86 0.17
87 0.14
88 0.14
89 0.14
90 0.12
91 0.09
92 0.08
93 0.08
94 0.1
95 0.12
96 0.15
97 0.16
98 0.16
99 0.16
100 0.15
101 0.15
102 0.13
103 0.11
104 0.08
105 0.08
106 0.08
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.08
114 0.09
115 0.13
116 0.14
117 0.16
118 0.19
119 0.23
120 0.22
121 0.25
122 0.27
123 0.23
124 0.26
125 0.25
126 0.23
127 0.19
128 0.2
129 0.19
130 0.18
131 0.19
132 0.19
133 0.2
134 0.26
135 0.27
136 0.26
137 0.23
138 0.21
139 0.25
140 0.24
141 0.23
142 0.19
143 0.22
144 0.21
145 0.22
146 0.23
147 0.17
148 0.17
149 0.19
150 0.19
151 0.19
152 0.21
153 0.21
154 0.2
155 0.2
156 0.19
157 0.17
158 0.17
159 0.16
160 0.15
161 0.15
162 0.14
163 0.14
164 0.14
165 0.13
166 0.11
167 0.09
168 0.07
169 0.07
170 0.06
171 0.06
172 0.06
173 0.07
174 0.07
175 0.07
176 0.08
177 0.1
178 0.11
179 0.13
180 0.13
181 0.12
182 0.12
183 0.11
184 0.11
185 0.09
186 0.08
187 0.06
188 0.05
189 0.04
190 0.04
191 0.03
192 0.03
193 0.02
194 0.03
195 0.04
196 0.08
197 0.1
198 0.11
199 0.13
200 0.14
201 0.19
202 0.24
203 0.3
204 0.33
205 0.4
206 0.43
207 0.45
208 0.49
209 0.48
210 0.45
211 0.42
212 0.38
213 0.31
214 0.29
215 0.3
216 0.26
217 0.22
218 0.21
219 0.18
220 0.17
221 0.16
222 0.15
223 0.11
224 0.11
225 0.13
226 0.14
227 0.14
228 0.13
229 0.13
230 0.15
231 0.2
232 0.3
233 0.35
234 0.42
235 0.42
236 0.49
237 0.51
238 0.52
239 0.54
240 0.53
241 0.54
242 0.52
243 0.57
244 0.59
245 0.61
246 0.62
247 0.62
248 0.61
249 0.56
250 0.51
251 0.52