Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BNN4

Protein Details
Accession A0A165BNN4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-68SALASLPKRTFRRRPRYTRTDNVPEAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR003807  DUF202  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF02656  DUF202  
Amino Acid Sequences MASPPDATLRQSEDNEHDDDGGNSLLRRSWHAMSEILSPFSPSALASLPKRTFRRRPRYTRTDNVPEAERDEHGQMPTVRDYHAINSVPPQVRVPKKIATPIKVEGKVWFANERTWISYLNIAVLVGTLAMALFNASKDQIARNFAYAYAAISVGILVYGYVVYQHRITMIQKRDPGPFDQIVGPVVISAFLFAAILANFIIRVRELQRKETPIPGLFFLNPRQAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.33
4 0.28
5 0.24
6 0.23
7 0.2
8 0.16
9 0.13
10 0.11
11 0.11
12 0.13
13 0.13
14 0.17
15 0.2
16 0.21
17 0.23
18 0.25
19 0.26
20 0.25
21 0.31
22 0.28
23 0.25
24 0.23
25 0.21
26 0.19
27 0.17
28 0.16
29 0.09
30 0.09
31 0.09
32 0.13
33 0.15
34 0.23
35 0.27
36 0.35
37 0.41
38 0.48
39 0.56
40 0.63
41 0.73
42 0.75
43 0.81
44 0.84
45 0.88
46 0.88
47 0.87
48 0.85
49 0.83
50 0.75
51 0.67
52 0.6
53 0.5
54 0.45
55 0.37
56 0.29
57 0.22
58 0.21
59 0.2
60 0.17
61 0.2
62 0.18
63 0.19
64 0.2
65 0.19
66 0.17
67 0.16
68 0.17
69 0.14
70 0.19
71 0.16
72 0.15
73 0.17
74 0.23
75 0.23
76 0.23
77 0.23
78 0.25
79 0.29
80 0.32
81 0.33
82 0.3
83 0.31
84 0.39
85 0.42
86 0.37
87 0.37
88 0.39
89 0.42
90 0.39
91 0.38
92 0.31
93 0.3
94 0.27
95 0.24
96 0.21
97 0.16
98 0.16
99 0.18
100 0.18
101 0.15
102 0.15
103 0.15
104 0.13
105 0.14
106 0.13
107 0.11
108 0.09
109 0.08
110 0.07
111 0.06
112 0.05
113 0.03
114 0.03
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.03
122 0.03
123 0.04
124 0.04
125 0.05
126 0.08
127 0.1
128 0.14
129 0.15
130 0.16
131 0.16
132 0.15
133 0.16
134 0.14
135 0.12
136 0.09
137 0.08
138 0.06
139 0.06
140 0.06
141 0.04
142 0.04
143 0.03
144 0.02
145 0.02
146 0.02
147 0.02
148 0.04
149 0.05
150 0.07
151 0.07
152 0.08
153 0.08
154 0.11
155 0.14
156 0.21
157 0.27
158 0.32
159 0.37
160 0.4
161 0.44
162 0.44
163 0.45
164 0.42
165 0.37
166 0.33
167 0.29
168 0.26
169 0.22
170 0.2
171 0.17
172 0.1
173 0.09
174 0.07
175 0.05
176 0.05
177 0.04
178 0.04
179 0.04
180 0.04
181 0.05
182 0.05
183 0.06
184 0.05
185 0.05
186 0.06
187 0.06
188 0.07
189 0.06
190 0.1
191 0.14
192 0.24
193 0.27
194 0.35
195 0.42
196 0.48
197 0.51
198 0.54
199 0.56
200 0.51
201 0.51
202 0.45
203 0.41
204 0.36
205 0.37
206 0.35