Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165B9Q9

Protein Details
Accession A0A165B9Q9   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-105YVSAKALKKSRKSPRLRKLKDVPVTNHydrophilic
NLS Segment(s)
PositionSequence
85-98ALKKSRKSPRLRKL
Subcellular Location(s) mito 13.5, cyto_mito 8.833, nucl 7.5, cyto_nucl 5.833, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
Gene Ontology GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSKKWSLQQVAQHNTASSCWIIIENKVYDVTEFLPIHPGGVRLLLNFAGRDATAAFKPFHSSRALTDSLPPEKCLGEVDYVSAKALKKSRKSPRLRKLKDVPVTNVTPPSDDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.29
4 0.19
5 0.13
6 0.1
7 0.12
8 0.12
9 0.13
10 0.17
11 0.16
12 0.17
13 0.17
14 0.17
15 0.15
16 0.15
17 0.14
18 0.16
19 0.16
20 0.15
21 0.18
22 0.18
23 0.18
24 0.17
25 0.17
26 0.1
27 0.12
28 0.12
29 0.08
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.09
42 0.09
43 0.09
44 0.13
45 0.13
46 0.14
47 0.15
48 0.15
49 0.15
50 0.19
51 0.21
52 0.17
53 0.21
54 0.23
55 0.26
56 0.26
57 0.25
58 0.22
59 0.2
60 0.2
61 0.18
62 0.15
63 0.12
64 0.11
65 0.12
66 0.13
67 0.13
68 0.13
69 0.14
70 0.13
71 0.16
72 0.22
73 0.29
74 0.35
75 0.45
76 0.56
77 0.63
78 0.74
79 0.8
80 0.84
81 0.88
82 0.87
83 0.87
84 0.86
85 0.86
86 0.84
87 0.79
88 0.75
89 0.7
90 0.67
91 0.6
92 0.55
93 0.46