Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165F2J7

Protein Details
Accession A0A165F2J7    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-73VRALSKTRLRHPSSKKNCRRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MNTCCSYGKLSQTSSMSSRDPAQTLGPHSVAVHGLPQGKSLIHHEMKTSLTVWVRALSKTRLRHPSSKKNCRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.29
4 0.26
5 0.27
6 0.24
7 0.23
8 0.21
9 0.21
10 0.2
11 0.22
12 0.23
13 0.2
14 0.18
15 0.17
16 0.16
17 0.14
18 0.11
19 0.09
20 0.08
21 0.11
22 0.1
23 0.11
24 0.11
25 0.11
26 0.11
27 0.14
28 0.19
29 0.18
30 0.19
31 0.19
32 0.21
33 0.21
34 0.22
35 0.19
36 0.15
37 0.15
38 0.15
39 0.15
40 0.17
41 0.18
42 0.19
43 0.22
44 0.25
45 0.31
46 0.37
47 0.45
48 0.51
49 0.56
50 0.64
51 0.7
52 0.75
53 0.79