Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4UWC3

Protein Details
Accession J4UWC3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-56KDSAKSSDKTIEKKKKKVVEPESSDSHydrophilic
NLS Segment(s)
PositionSequence
13-47KAESKAVKSNGTTKASKAKDSAKSSDKTIEKKKKK
398-437GDRRGGFGGGRGGGRGGRGGGRGGPRGGGRGGFGGRGGGR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005635  C:nuclear envelope  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0008139  F:nuclear localization sequence binding  
GO:0003723  F:RNA binding  
GO:0043047  F:single-stranded telomeric DNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MAKSTTKVAKPSKAESKAVKSNGTTKASKAKDSAKSSDKTIEKKKKKVVEPESSDSDSESDSESEASASDSDASEEEAPKKPVANGKKVKAAEKSESDEDSDSDSDESEDEKPAAKANGKKAAAEDSDDSDDSDDSDSDNEDEKAAPKAASAKKDDSDSDSDDSDDSDSEEEEKTEAAPSKKRKAEDEIDEAPKKAKSDDAPMTLFAGSLSWGVDDNALYEAFKSFGNIVSARVVTDKNTGRSRGFGYVDFGDSESATKAYEAMQGQEIDGRALNLDYANAKPTEGKPQDRAADRAKRHGDTLSAESDTLFVGNLPFDTEQDTVRQFFSEVAEVASVRLPTDPDSGNLKGFGYVTFNSIEDAKSALDAKNGASIGNGRNSRAVRLDFAGSRPPQNGGGDRRGGFGGGRGGGRGGRGGGRGGPRGGGRGGFGGRGGGRGGFSGTKTSFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.7
4 0.7
5 0.69
6 0.64
7 0.57
8 0.59
9 0.6
10 0.59
11 0.51
12 0.47
13 0.52
14 0.51
15 0.52
16 0.49
17 0.5
18 0.53
19 0.58
20 0.62
21 0.6
22 0.59
23 0.58
24 0.61
25 0.59
26 0.58
27 0.63
28 0.66
29 0.68
30 0.75
31 0.81
32 0.81
33 0.83
34 0.85
35 0.84
36 0.84
37 0.83
38 0.8
39 0.77
40 0.7
41 0.61
42 0.51
43 0.42
44 0.31
45 0.24
46 0.19
47 0.13
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.09
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.11
61 0.12
62 0.14
63 0.17
64 0.21
65 0.23
66 0.23
67 0.25
68 0.26
69 0.32
70 0.38
71 0.45
72 0.49
73 0.51
74 0.59
75 0.6
76 0.62
77 0.61
78 0.59
79 0.55
80 0.51
81 0.52
82 0.47
83 0.46
84 0.42
85 0.36
86 0.3
87 0.27
88 0.22
89 0.17
90 0.14
91 0.13
92 0.11
93 0.11
94 0.12
95 0.09
96 0.11
97 0.1
98 0.12
99 0.12
100 0.14
101 0.17
102 0.21
103 0.26
104 0.31
105 0.4
106 0.39
107 0.39
108 0.38
109 0.4
110 0.35
111 0.33
112 0.27
113 0.21
114 0.23
115 0.22
116 0.21
117 0.17
118 0.15
119 0.13
120 0.12
121 0.09
122 0.07
123 0.07
124 0.08
125 0.08
126 0.1
127 0.09
128 0.09
129 0.1
130 0.1
131 0.12
132 0.13
133 0.12
134 0.11
135 0.19
136 0.23
137 0.27
138 0.31
139 0.32
140 0.32
141 0.34
142 0.35
143 0.3
144 0.3
145 0.28
146 0.25
147 0.22
148 0.21
149 0.19
150 0.18
151 0.14
152 0.11
153 0.08
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.09
163 0.13
164 0.14
165 0.21
166 0.27
167 0.36
168 0.4
169 0.41
170 0.42
171 0.45
172 0.49
173 0.48
174 0.49
175 0.46
176 0.48
177 0.47
178 0.44
179 0.38
180 0.33
181 0.27
182 0.21
183 0.19
184 0.14
185 0.21
186 0.25
187 0.26
188 0.26
189 0.26
190 0.27
191 0.23
192 0.21
193 0.13
194 0.09
195 0.06
196 0.05
197 0.05
198 0.04
199 0.04
200 0.04
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.06
210 0.06
211 0.06
212 0.05
213 0.06
214 0.09
215 0.09
216 0.09
217 0.1
218 0.1
219 0.1
220 0.11
221 0.1
222 0.09
223 0.15
224 0.17
225 0.21
226 0.23
227 0.26
228 0.25
229 0.27
230 0.28
231 0.26
232 0.25
233 0.2
234 0.2
235 0.19
236 0.19
237 0.17
238 0.15
239 0.11
240 0.09
241 0.1
242 0.07
243 0.06
244 0.06
245 0.05
246 0.05
247 0.06
248 0.1
249 0.1
250 0.1
251 0.12
252 0.12
253 0.13
254 0.14
255 0.13
256 0.1
257 0.09
258 0.08
259 0.06
260 0.06
261 0.07
262 0.05
263 0.05
264 0.06
265 0.07
266 0.09
267 0.09
268 0.09
269 0.11
270 0.12
271 0.22
272 0.26
273 0.29
274 0.31
275 0.36
276 0.41
277 0.41
278 0.45
279 0.43
280 0.47
281 0.45
282 0.5
283 0.5
284 0.45
285 0.44
286 0.41
287 0.35
288 0.3
289 0.31
290 0.25
291 0.2
292 0.19
293 0.18
294 0.17
295 0.14
296 0.11
297 0.07
298 0.05
299 0.04
300 0.05
301 0.05
302 0.06
303 0.07
304 0.07
305 0.1
306 0.11
307 0.11
308 0.14
309 0.16
310 0.15
311 0.15
312 0.15
313 0.12
314 0.13
315 0.14
316 0.13
317 0.11
318 0.11
319 0.11
320 0.1
321 0.11
322 0.11
323 0.1
324 0.08
325 0.09
326 0.09
327 0.11
328 0.15
329 0.15
330 0.15
331 0.21
332 0.22
333 0.22
334 0.22
335 0.2
336 0.17
337 0.16
338 0.15
339 0.13
340 0.13
341 0.13
342 0.14
343 0.14
344 0.13
345 0.14
346 0.13
347 0.1
348 0.11
349 0.09
350 0.09
351 0.11
352 0.11
353 0.12
354 0.13
355 0.13
356 0.16
357 0.16
358 0.14
359 0.13
360 0.16
361 0.18
362 0.25
363 0.26
364 0.23
365 0.29
366 0.3
367 0.32
368 0.33
369 0.32
370 0.27
371 0.28
372 0.32
373 0.28
374 0.29
375 0.35
376 0.32
377 0.33
378 0.32
379 0.31
380 0.3
381 0.32
382 0.37
383 0.35
384 0.4
385 0.42
386 0.42
387 0.42
388 0.38
389 0.35
390 0.28
391 0.24
392 0.22
393 0.18
394 0.18
395 0.16
396 0.17
397 0.17
398 0.18
399 0.16
400 0.14
401 0.14
402 0.15
403 0.16
404 0.2
405 0.24
406 0.27
407 0.27
408 0.28
409 0.27
410 0.28
411 0.29
412 0.24
413 0.2
414 0.21
415 0.22
416 0.19
417 0.18
418 0.19
419 0.17
420 0.18
421 0.18
422 0.14
423 0.13
424 0.13
425 0.16
426 0.15
427 0.15
428 0.21