Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4KLU7

Protein Details
Accession J4KLU7    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
167-193MVKRYMVKDIKRNRDPTRKRVPKADVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, mito_nucl 13.333, cyto_mito 11.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
PROSITE View protein in PROSITE  
PS01167  RIBOSOMAL_L17  
Amino Acid Sequences MAGGLTKYRHLGRKSSARNALLRGLVTSLVQHEHIQTTYAKAKEAQRLAEKLITLAKRDNEPCRRSAQGILYLPHIHLPKLFGPLKERYMDREGGYTRVVRTEPMNTYDQAESAILEFVDGERDSRFMMTAKTVARDRMLGMEHRDLTRENIEKVTKHRGEAEFEAMVKRYMVKDIKRNRDPTRKRVPKADVSIGDVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.69
4 0.66
5 0.66
6 0.63
7 0.59
8 0.5
9 0.42
10 0.33
11 0.26
12 0.21
13 0.18
14 0.15
15 0.12
16 0.12
17 0.13
18 0.13
19 0.13
20 0.15
21 0.15
22 0.16
23 0.14
24 0.18
25 0.22
26 0.22
27 0.22
28 0.24
29 0.3
30 0.36
31 0.39
32 0.4
33 0.39
34 0.41
35 0.42
36 0.4
37 0.34
38 0.27
39 0.3
40 0.26
41 0.22
42 0.24
43 0.23
44 0.27
45 0.32
46 0.4
47 0.43
48 0.44
49 0.45
50 0.45
51 0.45
52 0.42
53 0.41
54 0.36
55 0.34
56 0.34
57 0.32
58 0.31
59 0.29
60 0.27
61 0.27
62 0.23
63 0.16
64 0.13
65 0.15
66 0.14
67 0.2
68 0.22
69 0.2
70 0.23
71 0.27
72 0.29
73 0.29
74 0.28
75 0.25
76 0.27
77 0.28
78 0.24
79 0.24
80 0.22
81 0.21
82 0.22
83 0.18
84 0.15
85 0.15
86 0.14
87 0.11
88 0.12
89 0.14
90 0.14
91 0.16
92 0.18
93 0.16
94 0.19
95 0.18
96 0.17
97 0.14
98 0.12
99 0.09
100 0.07
101 0.07
102 0.05
103 0.04
104 0.04
105 0.04
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.08
114 0.07
115 0.08
116 0.09
117 0.12
118 0.12
119 0.16
120 0.17
121 0.18
122 0.18
123 0.18
124 0.17
125 0.17
126 0.18
127 0.17
128 0.2
129 0.23
130 0.24
131 0.24
132 0.25
133 0.22
134 0.24
135 0.28
136 0.27
137 0.24
138 0.27
139 0.29
140 0.31
141 0.34
142 0.42
143 0.37
144 0.35
145 0.41
146 0.38
147 0.41
148 0.41
149 0.41
150 0.32
151 0.31
152 0.31
153 0.25
154 0.23
155 0.17
156 0.16
157 0.13
158 0.19
159 0.25
160 0.3
161 0.39
162 0.49
163 0.59
164 0.66
165 0.74
166 0.77
167 0.81
168 0.83
169 0.84
170 0.85
171 0.85
172 0.82
173 0.83
174 0.81
175 0.8
176 0.79
177 0.78
178 0.69