FuNGI

A0A163J8L5

Protein Details

Accession

A0A163J8L5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
343-369	ADARGGHRERRRQDREREQERDRRNAQ	Basic

NLS Segment(s)

Position	Sequence
351-355	RERRR

Subcellular Location(s)

mito 25

Family & Domain DBs

InterPro	View protein in InterPro IPR038883 AN11006-like

Amino Acid Sequences

MASQSSRTSTPRSRSSSASSASSDTTMLDAPTHLPLAPARPRQASPPPADPAFSLLLSLPRELRDRIYTFALTAAYPFWWPSHAPAKHDVAVSLLQTCKQLHDEAAPVLYTANKFLFTHPSDCNIFRVVASPHADRIHSVWFRIREKDLRLWTAYLSSKSADRSLKADLPRLKNLCIFMRCLSLGTPRLLGLLGVQGAGGAGGAGGVAVLPPPMAVQVQAVQNAVGQQVAALHQHTSHPSRPTRPPPHTQTQDRTTTLSPXPPPPPPPPAVPFAAFAAGAVPHHHPQPPAPAAAQGHPNLNVLTTFLRFERELGIESLCMSLRETLHDPSHRVVAHQPTAPAGADARGGHRERRRQDREREQERDRRNAQSEHGERDKSGDTDTPREIPDVKIVCIMRVPKPEVSRLVRMYPEELSVDRNGDARTRFRRLRGADVCVEISGFEGVQG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.59
2	0.63
3	0.63
4	0.58
5	0.53
6	0.46
7	0.41
8	0.38
9	0.34
10	0.27
11	0.2
12	0.18
13	0.15
14	0.13
15	0.11
16	0.11
17	0.11
18	0.13
19	0.14
20	0.12
21	0.12
22	0.14
23	0.21
24	0.29
25	0.34
26	0.37
27	0.41
28	0.42
29	0.48
30	0.56
31	0.56
32	0.54
33	0.54
34	0.55
35	0.51
36	0.51
37	0.44
38	0.38
39	0.32
40	0.26
41	0.19
42	0.15
43	0.18
44	0.18
45	0.2
46	0.17
47	0.18
48	0.21
49	0.22
50	0.25
51	0.28
52	0.29
53	0.31
54	0.33
55	0.31
56	0.28
57	0.28
58	0.25
59	0.18
60	0.16
61	0.13
62	0.1
63	0.1
64	0.11
65	0.09
66	0.1
67	0.11
68	0.16
69	0.25
70	0.27
71	0.3
72	0.35
73	0.4
74	0.41
75	0.41
76	0.36
77	0.28
78	0.27
79	0.24
80	0.21
81	0.17
82	0.15
83	0.17
84	0.17
85	0.17
86	0.18
87	0.18
88	0.16
89	0.18
90	0.2
91	0.18
92	0.18
93	0.16
94	0.14
95	0.13
96	0.13
97	0.11
98	0.11
99	0.1
100	0.11
101	0.12
102	0.14
103	0.21
104	0.22
105	0.27
106	0.26
107	0.29
108	0.31
109	0.31
110	0.32
111	0.25
112	0.23
113	0.18
114	0.2
115	0.17
116	0.19
117	0.22
118	0.21
119	0.23
120	0.24
121	0.24
122	0.21
123	0.22
124	0.25
125	0.22
126	0.23
127	0.25
128	0.3
129	0.33
130	0.36
131	0.38
132	0.35
133	0.39
134	0.45
135	0.45
136	0.42
137	0.41
138	0.38
139	0.33
140	0.33
141	0.3
142	0.24
143	0.2
144	0.17
145	0.18
146	0.18
147	0.23
148	0.2
149	0.19
150	0.2
151	0.23
152	0.27
153	0.27
154	0.33
155	0.35
156	0.38
157	0.45
158	0.44
159	0.42
160	0.39
161	0.4
162	0.38
163	0.32
164	0.3
165	0.23
166	0.24
167	0.22
168	0.21
169	0.19
170	0.17
171	0.18
172	0.17
173	0.16
174	0.14
175	0.14
176	0.13
177	0.12
178	0.08
179	0.06
180	0.06
181	0.05
182	0.05
183	0.04
184	0.04
185	0.04
186	0.03
187	0.02
188	0.02
189	0.01
190	0.01
191	0.01
192	0.01
193	0.01
194	0.01
195	0.02
196	0.02
197	0.02
198	0.02
199	0.02
200	0.03
201	0.03
202	0.03
203	0.04
204	0.07
205	0.08
206	0.09
207	0.09
208	0.09
209	0.09
210	0.09
211	0.09
212	0.06
213	0.04
214	0.04
215	0.04
216	0.05
217	0.05
218	0.05
219	0.05
220	0.06
221	0.07
222	0.1
223	0.13
224	0.17
225	0.22
226	0.25
227	0.31
228	0.38
229	0.47
230	0.54
231	0.56
232	0.6
233	0.61
234	0.68
235	0.7
236	0.68
237	0.65
238	0.61
239	0.61
240	0.53
241	0.49
242	0.4
243	0.38
244	0.34
245	0.33
246	0.3
247	0.29
248	0.32
249	0.34
250	0.36
251	0.35
252	0.38
253	0.36
254	0.36
255	0.35
256	0.34
257	0.3
258	0.28
259	0.25
260	0.2
261	0.16
262	0.13
263	0.1
264	0.08
265	0.07
266	0.07
267	0.09
268	0.1
269	0.12
270	0.14
271	0.14
272	0.15
273	0.23
274	0.23
275	0.22
276	0.21
277	0.22
278	0.22
279	0.24
280	0.27
281	0.2
282	0.2
283	0.19
284	0.2
285	0.16
286	0.15
287	0.13
288	0.1
289	0.1
290	0.1
291	0.1
292	0.09
293	0.12
294	0.12
295	0.13
296	0.14
297	0.14
298	0.15
299	0.15
300	0.15
301	0.13
302	0.13
303	0.13
304	0.1
305	0.1
306	0.08
307	0.1
308	0.1
309	0.14
310	0.16
311	0.19
312	0.24
313	0.27
314	0.28
315	0.27
316	0.32
317	0.28
318	0.27
319	0.29
320	0.3
321	0.32
322	0.31
323	0.3
324	0.26
325	0.28
326	0.26
327	0.21
328	0.14
329	0.11
330	0.11
331	0.11
332	0.13
333	0.18
334	0.2
335	0.27
336	0.34
337	0.43
338	0.49
339	0.59
340	0.66
341	0.69
342	0.78
343	0.82
344	0.85
345	0.86
346	0.86
347	0.84
348	0.84
349	0.81
350	0.8
351	0.74
352	0.71
353	0.67
354	0.62
355	0.57
356	0.59
357	0.56
358	0.55
359	0.56
360	0.49
361	0.43
362	0.44
363	0.42
364	0.32
365	0.3
366	0.28
367	0.26
368	0.3
369	0.33
370	0.32
371	0.3
372	0.32
373	0.31
374	0.27
375	0.32
376	0.29
377	0.26
378	0.29
379	0.29
380	0.27
381	0.3
382	0.32
383	0.3
384	0.35
385	0.38
386	0.39
387	0.42
388	0.47
389	0.51
390	0.53
391	0.55
392	0.51
393	0.52
394	0.49
395	0.48
396	0.45
397	0.38
398	0.34
399	0.29
400	0.26
401	0.25
402	0.23
403	0.22
404	0.2
405	0.22
406	0.21
407	0.23
408	0.27
409	0.32
410	0.38
411	0.45
412	0.5
413	0.53
414	0.61
415	0.61
416	0.67
417	0.65
418	0.64
419	0.59
420	0.58
421	0.53
422	0.44
423	0.39
424	0.28
425	0.22
426	0.16

A0A163J8L5

3D AlphaFold-predicted Structure Viewer