Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4UJD4

Protein Details
Accession J4UJD4    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-105ALKEPPRDRKKEKNIKHNKSVABasic
NLS Segment(s)
PositionSequence
87-99EPPRDRKKEKNIK
Subcellular Location(s) cyto 22, pero 2, mito_nucl 2, nucl 1.5, mito 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000911  Ribosomal_L11/L12  
IPR036796  Ribosomal_L11/L12_N_sf  
IPR020783  Ribosomal_L11_C  
IPR036769  Ribosomal_L11_C_sf  
IPR020785  Ribosomal_L11_CS  
IPR020784  Ribosomal_L11_N  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00298  Ribosomal_L11  
PF03946  Ribosomal_L11_N  
PROSITE View protein in PROSITE  
PS00359  RIBOSOMAL_L11  
CDD cd00349  Ribosomal_L11  
Amino Acid Sequences MPPKIDPNEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATGDWKGLRVTVKLTIQNRQAAVSVVPTASSLIIRALKEPPRDRKKEKNIKHNKSVALDEIIEIARTMRYKSFSKELKGTVKEILGTAYSVGCRVDGKPPKVIIEAIDNGEIDIPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.2
4 0.23
5 0.2
6 0.15
7 0.13
8 0.1
9 0.1
10 0.09
11 0.08
12 0.05
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.08
19 0.08
20 0.08
21 0.07
22 0.16
23 0.2
24 0.23
25 0.23
26 0.23
27 0.24
28 0.24
29 0.25
30 0.2
31 0.2
32 0.2
33 0.23
34 0.22
35 0.2
36 0.21
37 0.2
38 0.19
39 0.15
40 0.13
41 0.11
42 0.13
43 0.14
44 0.14
45 0.15
46 0.17
47 0.2
48 0.25
49 0.26
50 0.29
51 0.31
52 0.33
53 0.32
54 0.28
55 0.25
56 0.2
57 0.18
58 0.14
59 0.11
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.06
68 0.08
69 0.08
70 0.09
71 0.13
72 0.18
73 0.24
74 0.3
75 0.39
76 0.46
77 0.53
78 0.59
79 0.65
80 0.72
81 0.76
82 0.78
83 0.79
84 0.81
85 0.82
86 0.84
87 0.79
88 0.72
89 0.64
90 0.57
91 0.48
92 0.38
93 0.31
94 0.22
95 0.18
96 0.14
97 0.11
98 0.09
99 0.08
100 0.07
101 0.08
102 0.09
103 0.1
104 0.15
105 0.17
106 0.22
107 0.3
108 0.34
109 0.38
110 0.42
111 0.45
112 0.49
113 0.49
114 0.47
115 0.41
116 0.37
117 0.32
118 0.28
119 0.23
120 0.15
121 0.13
122 0.11
123 0.1
124 0.09
125 0.09
126 0.09
127 0.08
128 0.09
129 0.1
130 0.2
131 0.28
132 0.31
133 0.37
134 0.39
135 0.41
136 0.42
137 0.41
138 0.33
139 0.31
140 0.31
141 0.26
142 0.26
143 0.23
144 0.21
145 0.21