Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163KNH9

Protein Details
Accession A0A163KNH9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
171-197KTEARGVDVKPKRERRTKIKTEIEEESBasic
NLS Segment(s)
PositionSequence
143-157KEQKEWDKAQKKGAK
180-188KPKRERRTK
Subcellular Location(s) cyto 11, cyto_mito 10.833, mito 9.5, cyto_nucl 9.333, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025494  DUF4385  
Pfam View protein in Pfam  
PF14328  DUF4385  
Amino Acid Sequences MPAQGLTKAQRMSYRIGRGEMGVLTFEPYKSEMLPSWRFKTPAVARKSAADIYARFVAYDDADDFVGMDMARKFLQMGMTRAKRYANHKGGSKYDKATGEALVQDEDFEGRAEKLEASLVFKEVWEKAKRHDGYQSKKERFQKEQKEWDKAQKKGAKTEVKGEGGSGVDVKTEARGVDVKPKRERRTKIKTEIEEESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.44
4 0.42
5 0.38
6 0.37
7 0.31
8 0.23
9 0.16
10 0.13
11 0.13
12 0.13
13 0.12
14 0.12
15 0.12
16 0.13
17 0.12
18 0.15
19 0.15
20 0.22
21 0.3
22 0.35
23 0.38
24 0.41
25 0.41
26 0.39
27 0.47
28 0.48
29 0.49
30 0.49
31 0.48
32 0.45
33 0.46
34 0.49
35 0.4
36 0.33
37 0.27
38 0.21
39 0.22
40 0.24
41 0.21
42 0.18
43 0.17
44 0.16
45 0.13
46 0.14
47 0.1
48 0.08
49 0.08
50 0.08
51 0.07
52 0.06
53 0.07
54 0.05
55 0.07
56 0.06
57 0.07
58 0.08
59 0.07
60 0.08
61 0.08
62 0.13
63 0.14
64 0.17
65 0.24
66 0.28
67 0.29
68 0.3
69 0.31
70 0.3
71 0.34
72 0.41
73 0.4
74 0.4
75 0.44
76 0.46
77 0.5
78 0.5
79 0.46
80 0.37
81 0.35
82 0.31
83 0.28
84 0.26
85 0.21
86 0.17
87 0.15
88 0.14
89 0.1
90 0.08
91 0.07
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.05
99 0.06
100 0.05
101 0.06
102 0.07
103 0.07
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.11
110 0.12
111 0.18
112 0.2
113 0.21
114 0.23
115 0.34
116 0.35
117 0.35
118 0.42
119 0.45
120 0.49
121 0.58
122 0.65
123 0.6
124 0.66
125 0.73
126 0.71
127 0.71
128 0.73
129 0.74
130 0.73
131 0.79
132 0.79
133 0.79
134 0.76
135 0.77
136 0.75
137 0.67
138 0.68
139 0.63
140 0.59
141 0.59
142 0.64
143 0.62
144 0.55
145 0.6
146 0.58
147 0.54
148 0.51
149 0.43
150 0.35
151 0.26
152 0.25
153 0.18
154 0.1
155 0.08
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.09
162 0.12
163 0.14
164 0.24
165 0.31
166 0.38
167 0.48
168 0.58
169 0.65
170 0.72
171 0.8
172 0.8
173 0.85
174 0.87
175 0.87
176 0.87
177 0.85
178 0.81