Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163C0W1

Protein Details
Accession A0A163C0W1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-40VQAIRAKRKGGKKVPKKYRKYHTAHTNKKEKBasic
NLS Segment(s)
PositionSequence
13-46IRAKRKGGKKVPKKYRKYHTAHTNKKEKGKKKSG
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MLERPPPHSVQAIRAKRKGGKKVPKKYRKYHTAHTNKKEKGKKKSGGQMATRAFSALRRIIEHVVSSLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.6
4 0.67
5 0.68
6 0.68
7 0.69
8 0.72
9 0.8
10 0.85
11 0.89
12 0.89
13 0.88
14 0.88
15 0.87
16 0.82
17 0.8
18 0.8
19 0.81
20 0.81
21 0.8
22 0.8
23 0.74
24 0.77
25 0.76
26 0.74
27 0.73
28 0.73
29 0.73
30 0.71
31 0.76
32 0.76
33 0.74
34 0.7
35 0.68
36 0.61
37 0.54
38 0.46
39 0.38
40 0.3
41 0.24
42 0.25
43 0.21
44 0.2
45 0.21
46 0.24
47 0.27
48 0.28
49 0.27