Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163HAB2

Protein Details
Accession A0A163HAB2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
285-322HASAQPRAHPRAKRKAHQQPTAVPRRSTRRKIVTAVCTHydrophilic
NLS Segment(s)
PositionSequence
290-314PRAHPRAKRKAHQQPTAVPRRSTRR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.833, cyto 8, cyto_mito 5.333
Family & Domain DBs
Amino Acid Sequences MPPLHIDKISLASFQATLSRYTDTAPSALSELDSLRYDTIPSKLAKSEGDASLQKADVEKLVEWKLKHGTYRPALLGLVKSNPAGLVKSTTQEAFASLRADRDAIKALKILTRLRGIGPATASLLLSVFQPAAVPFFSDELFRWARWDASGTTGWGRSIKYTISEYSELLAGVEAMRQRLGVSAVDAEKAAYVLGRERVAMNVDVDVNVDVDVDMDVNVDVAKAEQHAARVEDEKASPAPASPYEAAADNIPKQRTKRSPSGTNPEATNPHPNAASDRAKTPQAHASAQPRAHPRAKRKAHQQPTAVPRRSTRRKIVTAVCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.15
4 0.16
5 0.17
6 0.19
7 0.18
8 0.19
9 0.21
10 0.18
11 0.18
12 0.16
13 0.16
14 0.15
15 0.14
16 0.13
17 0.11
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.15
25 0.16
26 0.18
27 0.2
28 0.2
29 0.22
30 0.23
31 0.25
32 0.24
33 0.26
34 0.29
35 0.26
36 0.29
37 0.28
38 0.28
39 0.28
40 0.27
41 0.23
42 0.19
43 0.19
44 0.15
45 0.16
46 0.15
47 0.17
48 0.22
49 0.26
50 0.25
51 0.28
52 0.33
53 0.33
54 0.36
55 0.36
56 0.4
57 0.4
58 0.44
59 0.41
60 0.36
61 0.34
62 0.31
63 0.28
64 0.22
65 0.2
66 0.16
67 0.15
68 0.14
69 0.14
70 0.13
71 0.12
72 0.11
73 0.12
74 0.12
75 0.14
76 0.15
77 0.15
78 0.15
79 0.14
80 0.15
81 0.12
82 0.13
83 0.13
84 0.12
85 0.13
86 0.12
87 0.13
88 0.12
89 0.12
90 0.17
91 0.16
92 0.16
93 0.16
94 0.17
95 0.19
96 0.22
97 0.22
98 0.2
99 0.21
100 0.22
101 0.21
102 0.24
103 0.22
104 0.2
105 0.18
106 0.15
107 0.14
108 0.13
109 0.12
110 0.08
111 0.08
112 0.06
113 0.06
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.07
125 0.07
126 0.07
127 0.11
128 0.12
129 0.12
130 0.13
131 0.13
132 0.13
133 0.12
134 0.14
135 0.1
136 0.12
137 0.13
138 0.12
139 0.13
140 0.13
141 0.13
142 0.12
143 0.12
144 0.09
145 0.1
146 0.09
147 0.1
148 0.11
149 0.12
150 0.14
151 0.15
152 0.14
153 0.13
154 0.13
155 0.11
156 0.1
157 0.08
158 0.05
159 0.04
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.07
168 0.06
169 0.06
170 0.08
171 0.08
172 0.09
173 0.08
174 0.08
175 0.07
176 0.06
177 0.06
178 0.04
179 0.04
180 0.06
181 0.08
182 0.08
183 0.09
184 0.09
185 0.1
186 0.11
187 0.12
188 0.1
189 0.09
190 0.09
191 0.08
192 0.09
193 0.08
194 0.07
195 0.06
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.03
207 0.03
208 0.03
209 0.04
210 0.04
211 0.06
212 0.06
213 0.08
214 0.1
215 0.11
216 0.13
217 0.15
218 0.15
219 0.16
220 0.16
221 0.16
222 0.15
223 0.15
224 0.13
225 0.12
226 0.14
227 0.12
228 0.16
229 0.15
230 0.15
231 0.15
232 0.16
233 0.16
234 0.15
235 0.18
236 0.18
237 0.23
238 0.24
239 0.27
240 0.29
241 0.38
242 0.45
243 0.5
244 0.56
245 0.59
246 0.66
247 0.71
248 0.79
249 0.73
250 0.67
251 0.62
252 0.56
253 0.51
254 0.44
255 0.44
256 0.36
257 0.34
258 0.31
259 0.3
260 0.3
261 0.34
262 0.37
263 0.31
264 0.33
265 0.34
266 0.39
267 0.39
268 0.39
269 0.38
270 0.36
271 0.37
272 0.4
273 0.44
274 0.47
275 0.48
276 0.5
277 0.5
278 0.53
279 0.57
280 0.6
281 0.62
282 0.65
283 0.73
284 0.76
285 0.8
286 0.84
287 0.87
288 0.87
289 0.84
290 0.83
291 0.83
292 0.85
293 0.8
294 0.72
295 0.7
296 0.72
297 0.76
298 0.75
299 0.75
300 0.74
301 0.75
302 0.79