Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163DB45

Protein Details
Accession A0A163DB45    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-99GFLSRLRTKKGRKLLMRRLTRGRWNLHydrophilic
NLS Segment(s)
PositionSequence
69-95RKRRHGFLSRLRTKKGRKLLMRRLTRG
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSLLNSRRPMLAPASLPATLAAPGSAPSSVTSSSETLDLVAKISAHPAFAALQIRCGPRDTYNPSHIVRKRRHGFLSRLRTKKGRKLLMRRLTRGRWNLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.21
5 0.17
6 0.13
7 0.12
8 0.09
9 0.06
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.09
16 0.1
17 0.1
18 0.12
19 0.11
20 0.12
21 0.12
22 0.11
23 0.09
24 0.1
25 0.09
26 0.07
27 0.07
28 0.07
29 0.06
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.12
38 0.1
39 0.12
40 0.14
41 0.15
42 0.15
43 0.16
44 0.16
45 0.15
46 0.22
47 0.27
48 0.3
49 0.33
50 0.37
51 0.37
52 0.45
53 0.47
54 0.5
55 0.49
56 0.54
57 0.57
58 0.59
59 0.64
60 0.62
61 0.66
62 0.68
63 0.72
64 0.72
65 0.71
66 0.7
67 0.72
68 0.73
69 0.73
70 0.73
71 0.72
72 0.72
73 0.78
74 0.84
75 0.85
76 0.86
77 0.85
78 0.84
79 0.82
80 0.81
81 0.78