A0A163DB45

UniProt ID: A0A163DB45   Organism: Didymella rabiei
Gene: ST47_g5858   Protein: Structural constituent of ribosome
Length: 126 AA

Protein Details

• Accession: A0A163DB45
• Localization Confidence: Medium
• Confidence Score: 11.1
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  74-99	GFLSRLRTKKGRKLLMRRLTRGRWNL	Hydrophilic

• NLS Segment(s):

  Position	Sequence
  69-95	RKRRHGFLSRLRTKKGRKLLMRRLTRG

• Subcellular Location(s): mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
• Family & Domain DBs:
  • InterPro:
    • IPR000271 Ribosomal_L34
  • Gene Ontology:
    • GO:1990904 C:ribonucleoprotein complex
    • GO:0005840 C:ribosome
    • GO:0003735 F:structural constituent of ribosome
    • GO:0006412 P:translation
  • Pfam:
    • PF00468 Ribosomal_L34
• Amino Acid Sequences: MSLLNSRRPMLAPASLPATLAAPGSAPSSVTSSSETLDLVAKISAHPAFAALQIRCGPRDTYNPSHIVRKRRHGFLSRLRTKKGRKLLMRRLTRGRWNLSH

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.26
2, 0.24
3, 0.23
4, 0.21
5, 0.17
6, 0.13
7, 0.12
8, 0.09
9, 0.06
10, 0.07
11, 0.07
12, 0.07
13, 0.07
14, 0.07
15, 0.09
16, 0.1
17, 0.1
18, 0.12
19, 0.11
20, 0.12
21, 0.12
22, 0.11
23, 0.09
24, 0.1
25, 0.09
26, 0.07
27, 0.07
28, 0.07
29, 0.06
30, 0.08
31, 0.08
32, 0.07
33, 0.07
34, 0.07
35, 0.07
36, 0.08
37, 0.12
38, 0.1
39, 0.12
40, 0.14
41, 0.15
42, 0.15
43, 0.16
44, 0.16
45, 0.15
46, 0.22
47, 0.27
48, 0.3
49, 0.33
50, 0.37
51, 0.37
52, 0.45
53, 0.47
54, 0.5
55, 0.49
56, 0.54
57, 0.57
58, 0.59
59, 0.64
60, 0.62
61, 0.66
62, 0.68
63, 0.72
64, 0.72
65, 0.71
66, 0.7
67, 0.72
68, 0.73
69, 0.73
70, 0.73
71, 0.72
72, 0.72
73, 0.78
74, 0.84
75, 0.85
76, 0.86
77, 0.85
78, 0.84
79, 0.82
80, 0.81
81, 0.78