Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4ULB1

Protein Details
Accession J4ULB1    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-117EKLAEKMHKKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
29-31PKK
57-113AKENEMKTEKKEERQRKVDAIREKRAKKAEKERYEKLAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MAETTPLPEVTQSEKPLGMRKNGKQWHAPKKAFRPTAGLTSYEKRTKERTLMAQMKAKENEMKTEKKEERQRKVDAIREKRAKKAEKERYEKLAEKMHKKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.35
4 0.36
5 0.39
6 0.42
7 0.45
8 0.53
9 0.58
10 0.6
11 0.62
12 0.68
13 0.7
14 0.72
15 0.72
16 0.7
17 0.74
18 0.79
19 0.73
20 0.65
21 0.6
22 0.52
23 0.53
24 0.46
25 0.38
26 0.32
27 0.33
28 0.37
29 0.35
30 0.34
31 0.3
32 0.33
33 0.35
34 0.36
35 0.36
36 0.36
37 0.41
38 0.46
39 0.47
40 0.47
41 0.45
42 0.45
43 0.41
44 0.37
45 0.31
46 0.25
47 0.28
48 0.28
49 0.3
50 0.28
51 0.36
52 0.38
53 0.43
54 0.52
55 0.55
56 0.6
57 0.63
58 0.64
59 0.63
60 0.66
61 0.65
62 0.65
63 0.64
64 0.64
65 0.67
66 0.66
67 0.65
68 0.68
69 0.68
70 0.67
71 0.7
72 0.71
73 0.72
74 0.77
75 0.76
76 0.74
77 0.73
78 0.68
79 0.62
80 0.61
81 0.58
82 0.61
83 0.64
84 0.67
85 0.68
86 0.67
87 0.72
88 0.74
89 0.77
90 0.78
91 0.8
92 0.82
93 0.84
94 0.92
95 0.94
96 0.94
97 0.93