Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163G580

Protein Details
Accession A0A163G580    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHAVVFDKNVTDKLNKDVQSYRLITVATLVDRLKINGSLARQALNDLEANGQIKKVVGHSKLSVYTRAVGDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.75
12 0.67
13 0.58
14 0.53
15 0.44
16 0.39
17 0.32
18 0.25
19 0.22
20 0.2
21 0.19
22 0.15
23 0.15
24 0.17
25 0.24
26 0.23
27 0.25
28 0.27
29 0.28
30 0.31
31 0.31
32 0.27
33 0.22
34 0.21
35 0.18
36 0.16
37 0.14
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.11
48 0.12
49 0.14
50 0.15
51 0.16
52 0.15
53 0.15
54 0.14
55 0.13
56 0.13
57 0.1
58 0.1
59 0.1
60 0.11
61 0.11
62 0.11
63 0.09
64 0.1
65 0.1
66 0.14
67 0.2
68 0.21
69 0.25
70 0.27
71 0.31
72 0.36
73 0.38
74 0.37
75 0.32
76 0.33
77 0.29