Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163HSF4

Protein Details
Accession A0A163HSF4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-103LDDRTVRKRRIKKVGIWTLQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 10.833, cyto_pero 10.333, nucl 5.5, pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012571  Mdm31/Mdm32  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0000001  P:mitochondrion inheritance  
Pfam View protein in Pfam  
PF08118  MDM31_MDM32  
Amino Acid Sequences MDLRVHLNDVRAAVPIFTRDISYVNNALVRPIVAYINSKRTFIPVNCRVVKQVGEFDGSWTLYDSGLMEEVSREMYDAFARDVLDDRTVRKRRIKKVGIWTLQLAAQALFLGLAGNMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.12
5 0.13
6 0.12
7 0.13
8 0.14
9 0.17
10 0.17
11 0.16
12 0.18
13 0.17
14 0.17
15 0.16
16 0.14
17 0.1
18 0.1
19 0.09
20 0.08
21 0.12
22 0.15
23 0.24
24 0.25
25 0.25
26 0.24
27 0.26
28 0.31
29 0.28
30 0.35
31 0.32
32 0.4
33 0.41
34 0.41
35 0.4
36 0.36
37 0.35
38 0.27
39 0.23
40 0.16
41 0.16
42 0.16
43 0.15
44 0.15
45 0.13
46 0.12
47 0.1
48 0.09
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.05
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.1
70 0.1
71 0.14
72 0.14
73 0.17
74 0.26
75 0.32
76 0.38
77 0.46
78 0.54
79 0.6
80 0.71
81 0.75
82 0.73
83 0.78
84 0.83
85 0.78
86 0.72
87 0.64
88 0.54
89 0.48
90 0.4
91 0.29
92 0.18
93 0.14
94 0.1
95 0.08
96 0.07
97 0.05
98 0.05