Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6EAV4

Protein Details
Accession J6EAV4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-90DESGRPISKRQKKLQKKSKLIEKKKEESRYTBasic
NLS Segment(s)
PositionSequence
64-85RPISKRQKKLQKKSKLIEKKKE
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSNPDDLDDGLAYDFDSEHEGVVDADDNVNSSLSPGLKKRPMEDDDNDADEKREERSLEDESGRPISKRQKKLQKKSKLIEKKKEESRYTVSQRKSIPTSSPEKVMEYLTTLIREKNPDLSALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.09
4 0.08
5 0.08
6 0.08
7 0.09
8 0.08
9 0.09
10 0.09
11 0.06
12 0.07
13 0.06
14 0.07
15 0.07
16 0.07
17 0.06
18 0.06
19 0.08
20 0.09
21 0.12
22 0.13
23 0.19
24 0.25
25 0.26
26 0.28
27 0.34
28 0.37
29 0.4
30 0.4
31 0.39
32 0.36
33 0.38
34 0.36
35 0.28
36 0.25
37 0.2
38 0.18
39 0.13
40 0.13
41 0.1
42 0.11
43 0.14
44 0.16
45 0.18
46 0.19
47 0.17
48 0.17
49 0.19
50 0.18
51 0.15
52 0.17
53 0.25
54 0.33
55 0.41
56 0.48
57 0.57
58 0.67
59 0.78
60 0.85
61 0.85
62 0.86
63 0.85
64 0.87
65 0.87
66 0.86
67 0.85
68 0.83
69 0.81
70 0.81
71 0.82
72 0.74
73 0.68
74 0.65
75 0.64
76 0.64
77 0.63
78 0.57
79 0.54
80 0.54
81 0.54
82 0.51
83 0.44
84 0.4
85 0.39
86 0.43
87 0.4
88 0.42
89 0.38
90 0.37
91 0.35
92 0.32
93 0.27
94 0.23
95 0.23
96 0.19
97 0.21
98 0.19
99 0.21
100 0.23
101 0.27
102 0.26
103 0.31
104 0.3