Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162Z520

Protein Details
Accession A0A162Z520   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-78DVEIPTRKLRRRNPKKTSPSPEKSSHydrophilic
NLS Segment(s)
PositionSequence
60-70RKLRRRNPKKT
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MRWSLIVKLKAHIPPNHPAHPAYSSTVVPQVQGNMSRLSGASSSASPTKRDVSDVEIPTRKLRRRNPKKTSPSPEKSSISEPALPASLKAAILAKRIEWLEANKTGGEAVADQIEEQLEVLEQRALSLNATAFRTWRKRAYLDEKGNAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.58
4 0.54
5 0.49
6 0.45
7 0.42
8 0.39
9 0.33
10 0.29
11 0.24
12 0.23
13 0.27
14 0.23
15 0.21
16 0.19
17 0.17
18 0.17
19 0.19
20 0.2
21 0.16
22 0.16
23 0.16
24 0.15
25 0.14
26 0.12
27 0.1
28 0.1
29 0.09
30 0.11
31 0.16
32 0.17
33 0.17
34 0.19
35 0.22
36 0.21
37 0.22
38 0.21
39 0.23
40 0.29
41 0.3
42 0.34
43 0.33
44 0.33
45 0.37
46 0.43
47 0.41
48 0.42
49 0.49
50 0.55
51 0.64
52 0.74
53 0.77
54 0.81
55 0.87
56 0.88
57 0.88
58 0.87
59 0.82
60 0.76
61 0.73
62 0.65
63 0.57
64 0.5
65 0.43
66 0.35
67 0.3
68 0.25
69 0.19
70 0.18
71 0.16
72 0.13
73 0.11
74 0.09
75 0.07
76 0.08
77 0.1
78 0.1
79 0.12
80 0.13
81 0.12
82 0.14
83 0.14
84 0.14
85 0.13
86 0.15
87 0.17
88 0.19
89 0.2
90 0.17
91 0.17
92 0.16
93 0.14
94 0.12
95 0.08
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.05
108 0.06
109 0.06
110 0.07
111 0.09
112 0.09
113 0.1
114 0.11
115 0.12
116 0.14
117 0.16
118 0.16
119 0.16
120 0.24
121 0.31
122 0.35
123 0.4
124 0.43
125 0.45
126 0.54
127 0.62
128 0.64
129 0.66
130 0.67