Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163BL69

Protein Details
Accession A0A163BL69    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-128EIETPSKKPRMVRKKKEVKSQTPEESDHydrophilic
NLS Segment(s)
PositionSequence
107-118SKKPRMVRKKKE
Subcellular Location(s) cyto 11.5, cyto_nucl 9.833, mito_nucl 7.833, mito 7.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MPPNKTASGEGGEGKFIWEGANENKLLLIILGRHIQTSEFEEVAQAFPGATGGAIRNRIGVLRAKQKKVYEELGWELPGGTTASAKKGKSTPSKRASDEDGEIETPSKKPRMVRKKKEVKSQTPEESDAKDEEEKVDYVKSEPDEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.13
4 0.11
5 0.08
6 0.11
7 0.13
8 0.18
9 0.17
10 0.17
11 0.16
12 0.16
13 0.15
14 0.12
15 0.09
16 0.06
17 0.08
18 0.11
19 0.11
20 0.12
21 0.12
22 0.12
23 0.13
24 0.16
25 0.17
26 0.14
27 0.13
28 0.14
29 0.14
30 0.14
31 0.13
32 0.08
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.07
41 0.09
42 0.09
43 0.09
44 0.1
45 0.1
46 0.11
47 0.15
48 0.18
49 0.27
50 0.33
51 0.35
52 0.39
53 0.41
54 0.42
55 0.41
56 0.4
57 0.31
58 0.27
59 0.27
60 0.23
61 0.21
62 0.18
63 0.14
64 0.1
65 0.1
66 0.07
67 0.05
68 0.05
69 0.06
70 0.1
71 0.14
72 0.14
73 0.16
74 0.19
75 0.27
76 0.36
77 0.43
78 0.49
79 0.54
80 0.59
81 0.59
82 0.6
83 0.57
84 0.51
85 0.45
86 0.37
87 0.3
88 0.25
89 0.23
90 0.21
91 0.17
92 0.15
93 0.17
94 0.18
95 0.18
96 0.24
97 0.35
98 0.46
99 0.56
100 0.65
101 0.73
102 0.81
103 0.86
104 0.91
105 0.9
106 0.89
107 0.86
108 0.84
109 0.81
110 0.75
111 0.71
112 0.63
113 0.55
114 0.48
115 0.4
116 0.34
117 0.28
118 0.24
119 0.22
120 0.22
121 0.2
122 0.19
123 0.19
124 0.17
125 0.16
126 0.21