Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162Z7E0

Protein Details
Accession A0A162Z7E0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
10-29GTTRKGPQFKPPRPVKAPAKHydrophilic
NLS Segment(s)
PositionSequence
13-43RKGPQFKPPRPVKAPAKASAAASRAAGASKR
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018552  CENP-X  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
GO:0051382  P:kinetochore assembly  
Pfam View protein in Pfam  
PF09415  CENP-X  
Amino Acid Sequences MPPKSASASGTTRKGPQFKPPRPVKAPAKASAAASRAAGASKRPNAPTARSDFQTETTIISSDEEDAQEDDFDALSDDLMEDVPAPKPTRAVEPVTTAHPIPAPLLARLLHENFEDTNTQIQKGAMTLTGRYMEIFVREALARAKHERARSARNDGISDGFLQVEDLEKLAPQLVLDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.54
4 0.59
5 0.62
6 0.69
7 0.72
8 0.75
9 0.73
10 0.8
11 0.79
12 0.77
13 0.76
14 0.7
15 0.67
16 0.58
17 0.55
18 0.51
19 0.43
20 0.33
21 0.27
22 0.22
23 0.17
24 0.17
25 0.15
26 0.14
27 0.2
28 0.25
29 0.29
30 0.3
31 0.35
32 0.37
33 0.4
34 0.43
35 0.43
36 0.41
37 0.37
38 0.4
39 0.36
40 0.35
41 0.33
42 0.27
43 0.21
44 0.18
45 0.17
46 0.13
47 0.12
48 0.1
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.04
70 0.05
71 0.08
72 0.09
73 0.09
74 0.1
75 0.11
76 0.15
77 0.17
78 0.19
79 0.18
80 0.2
81 0.21
82 0.21
83 0.22
84 0.18
85 0.16
86 0.13
87 0.12
88 0.09
89 0.1
90 0.1
91 0.09
92 0.1
93 0.1
94 0.11
95 0.13
96 0.14
97 0.13
98 0.12
99 0.13
100 0.12
101 0.13
102 0.12
103 0.11
104 0.16
105 0.15
106 0.15
107 0.15
108 0.15
109 0.13
110 0.13
111 0.13
112 0.1
113 0.1
114 0.1
115 0.11
116 0.12
117 0.12
118 0.11
119 0.12
120 0.1
121 0.11
122 0.12
123 0.1
124 0.11
125 0.11
126 0.12
127 0.14
128 0.17
129 0.19
130 0.22
131 0.29
132 0.32
133 0.36
134 0.43
135 0.46
136 0.53
137 0.55
138 0.6
139 0.57
140 0.55
141 0.53
142 0.46
143 0.42
144 0.34
145 0.29
146 0.21
147 0.16
148 0.13
149 0.12
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.08
156 0.09
157 0.1
158 0.1