Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6ED62

Protein Details
Accession J6ED62    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-66PLPTLKYKYKQNHAKKLKLQQDEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031765  Mdy2_get4-bd  
Pfam View protein in Pfam  
PF16843  Get5_bdg  
Amino Acid Sequences MSTSVSGPEHEFVSKFLTLATLSDPKLPKNYIRPLKDVANLGVPLPTLKYKYKQNHAKKLKLQQDEGGKNGRRPCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.13
4 0.13
5 0.11
6 0.12
7 0.14
8 0.14
9 0.14
10 0.2
11 0.21
12 0.21
13 0.25
14 0.26
15 0.26
16 0.3
17 0.4
18 0.43
19 0.45
20 0.47
21 0.46
22 0.48
23 0.46
24 0.39
25 0.3
26 0.24
27 0.21
28 0.18
29 0.15
30 0.11
31 0.09
32 0.09
33 0.1
34 0.11
35 0.13
36 0.18
37 0.27
38 0.35
39 0.45
40 0.54
41 0.63
42 0.71
43 0.78
44 0.83
45 0.82
46 0.84
47 0.83
48 0.79
49 0.72
50 0.67
51 0.68
52 0.63
53 0.58
54 0.57
55 0.52
56 0.51