Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165XX76

Protein Details
Accession A0A165XX76   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
162-187HPVPSDDDLKKKRKRQPSSRSVPGTNHydrophilic
NLS Segment(s)
PositionSequence
171-176KKKRKR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
IPR040015  UBL3-like  
IPR039540  UBL3-like_ubiquitin_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13881  Rad60-SLD_2  
Amino Acid Sequences MSESPYPPSLSASVQNTFAGQQEPLSEAVTVAPSLADDTEYQNRCEDDSEDIPSSAPMGMSASMGSSPTAVPTVPQIALTFLLVSGRRRSMTFDPDATVGRVKELIWNAWPADWQDERPPAPSYLRVLHLGKIWQDDDMLSSFQLAMVPAAPTIVHLAIRQHPVPSDDDLKKKRKRQPSSRSVPGTNTEEAVSGGCCGCIIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.25
4 0.23
5 0.22
6 0.18
7 0.13
8 0.12
9 0.12
10 0.13
11 0.13
12 0.13
13 0.12
14 0.1
15 0.1
16 0.11
17 0.09
18 0.07
19 0.06
20 0.05
21 0.06
22 0.06
23 0.06
24 0.06
25 0.11
26 0.2
27 0.22
28 0.23
29 0.24
30 0.24
31 0.24
32 0.25
33 0.21
34 0.19
35 0.2
36 0.23
37 0.22
38 0.22
39 0.21
40 0.19
41 0.19
42 0.13
43 0.1
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.05
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.07
60 0.09
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.05
69 0.07
70 0.08
71 0.09
72 0.11
73 0.12
74 0.13
75 0.13
76 0.18
77 0.2
78 0.24
79 0.25
80 0.24
81 0.23
82 0.23
83 0.24
84 0.2
85 0.18
86 0.12
87 0.1
88 0.1
89 0.08
90 0.11
91 0.11
92 0.11
93 0.1
94 0.12
95 0.12
96 0.11
97 0.12
98 0.09
99 0.12
100 0.12
101 0.12
102 0.15
103 0.18
104 0.19
105 0.21
106 0.22
107 0.19
108 0.2
109 0.21
110 0.2
111 0.2
112 0.21
113 0.23
114 0.22
115 0.22
116 0.22
117 0.22
118 0.2
119 0.2
120 0.18
121 0.14
122 0.14
123 0.12
124 0.12
125 0.11
126 0.1
127 0.08
128 0.08
129 0.07
130 0.07
131 0.08
132 0.06
133 0.05
134 0.05
135 0.06
136 0.05
137 0.06
138 0.05
139 0.05
140 0.07
141 0.07
142 0.07
143 0.08
144 0.11
145 0.16
146 0.21
147 0.21
148 0.2
149 0.21
150 0.23
151 0.25
152 0.26
153 0.29
154 0.31
155 0.39
156 0.47
157 0.55
158 0.62
159 0.69
160 0.74
161 0.77
162 0.82
163 0.84
164 0.87
165 0.88
166 0.89
167 0.9
168 0.87
169 0.8
170 0.73
171 0.68
172 0.62
173 0.52
174 0.43
175 0.34
176 0.27
177 0.24
178 0.21
179 0.15
180 0.11
181 0.1
182 0.09