Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6EC28

Protein Details
Accession J6EC28   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
145-168VHSTKTQSRKKKFSDVNVNKQPKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040107  Snu23  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046872  F:metal ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12874  zf-met  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSNFGRRTWDREEYAEKARSGYDDQSLKTTLTPTELQALKSKYINYDQLIKGSLKDLNKRKLTTNADSLSSFKRGKKFGFYCDVCNLTFKDTLQYIDHLNHKLHAIKFENLFDEPLIMDLRDNDDVPQEEFEQSYHELVKKFTEVHSTKTQSRKKKFSDVNVNKQPKKVTIQSPIKNESNINQMMGFANFGTSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.46
4 0.39
5 0.37
6 0.34
7 0.32
8 0.29
9 0.28
10 0.27
11 0.28
12 0.3
13 0.3
14 0.28
15 0.25
16 0.24
17 0.18
18 0.18
19 0.18
20 0.16
21 0.23
22 0.24
23 0.24
24 0.29
25 0.31
26 0.29
27 0.3
28 0.3
29 0.26
30 0.29
31 0.32
32 0.28
33 0.33
34 0.31
35 0.31
36 0.32
37 0.29
38 0.25
39 0.22
40 0.24
41 0.21
42 0.29
43 0.35
44 0.42
45 0.48
46 0.49
47 0.5
48 0.55
49 0.58
50 0.54
51 0.53
52 0.45
53 0.42
54 0.4
55 0.39
56 0.32
57 0.31
58 0.29
59 0.25
60 0.28
61 0.3
62 0.31
63 0.38
64 0.38
65 0.38
66 0.44
67 0.42
68 0.41
69 0.41
70 0.41
71 0.31
72 0.31
73 0.26
74 0.19
75 0.19
76 0.15
77 0.14
78 0.13
79 0.14
80 0.13
81 0.14
82 0.12
83 0.14
84 0.17
85 0.17
86 0.16
87 0.15
88 0.16
89 0.19
90 0.18
91 0.21
92 0.21
93 0.21
94 0.23
95 0.23
96 0.23
97 0.19
98 0.19
99 0.14
100 0.11
101 0.08
102 0.08
103 0.08
104 0.06
105 0.05
106 0.05
107 0.08
108 0.09
109 0.09
110 0.09
111 0.1
112 0.12
113 0.12
114 0.14
115 0.12
116 0.11
117 0.11
118 0.11
119 0.12
120 0.12
121 0.12
122 0.13
123 0.14
124 0.15
125 0.15
126 0.17
127 0.16
128 0.16
129 0.16
130 0.24
131 0.23
132 0.28
133 0.36
134 0.4
135 0.44
136 0.53
137 0.6
138 0.61
139 0.69
140 0.72
141 0.7
142 0.75
143 0.76
144 0.77
145 0.8
146 0.8
147 0.81
148 0.83
149 0.86
150 0.79
151 0.76
152 0.69
153 0.62
154 0.59
155 0.56
156 0.53
157 0.54
158 0.62
159 0.65
160 0.69
161 0.71
162 0.66
163 0.6
164 0.54
165 0.47
166 0.44
167 0.39
168 0.33
169 0.26
170 0.24
171 0.24
172 0.22
173 0.19
174 0.11
175 0.12