Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165X0G7

Protein Details
Accession A0A165X0G7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
160-188QSSSLRTHRDAQRRKRKEKARSTETDVRAHydrophilic
NLS Segment(s)
PositionSequence
170-180AQRRKRKEKAR
Subcellular Location(s) nucl 15, cyto_nucl 13.833, mito_nucl 10.665, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001969  Aspartic_peptidase_AS  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
PROSITE View protein in PROSITE  
PS00141  ASP_PROTEASE  
CDD cd00303  retropepsin_like  
Amino Acid Sequences PPGSSFLGSRAVQTDCYVLTYGQNSTPVMIDSGSDITLISEAAYKKISKDVKTKQGFRISLFEVTGKSKVTGFVTIPLYFDTPDGPVTLTVEAYVVKGMSTPLLIGNDYQDQYSLTIRRSEGETHLEFADTGRSIHIQNSTSTGPMDEEGKPIKIISKVQSSSLRTHRDAQRRKRKEKARSTETDVRALQKTAIKPGFCKKVPVKVNLKGRKEAYVEPIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.15
3 0.17
4 0.16
5 0.14
6 0.15
7 0.16
8 0.17
9 0.17
10 0.19
11 0.17
12 0.17
13 0.17
14 0.15
15 0.13
16 0.11
17 0.1
18 0.09
19 0.1
20 0.09
21 0.09
22 0.08
23 0.07
24 0.07
25 0.07
26 0.06
27 0.08
28 0.09
29 0.1
30 0.13
31 0.13
32 0.14
33 0.22
34 0.27
35 0.29
36 0.38
37 0.45
38 0.54
39 0.62
40 0.67
41 0.67
42 0.7
43 0.66
44 0.59
45 0.55
46 0.48
47 0.41
48 0.36
49 0.29
50 0.22
51 0.22
52 0.21
53 0.17
54 0.15
55 0.13
56 0.14
57 0.15
58 0.16
59 0.14
60 0.17
61 0.19
62 0.19
63 0.19
64 0.17
65 0.17
66 0.14
67 0.14
68 0.1
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.08
76 0.07
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.05
93 0.07
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.08
100 0.11
101 0.11
102 0.1
103 0.12
104 0.12
105 0.13
106 0.14
107 0.15
108 0.15
109 0.19
110 0.19
111 0.18
112 0.18
113 0.17
114 0.15
115 0.14
116 0.13
117 0.08
118 0.08
119 0.07
120 0.08
121 0.08
122 0.1
123 0.13
124 0.12
125 0.13
126 0.16
127 0.16
128 0.15
129 0.15
130 0.13
131 0.11
132 0.1
133 0.13
134 0.1
135 0.12
136 0.13
137 0.14
138 0.14
139 0.13
140 0.16
141 0.16
142 0.19
143 0.21
144 0.27
145 0.27
146 0.32
147 0.39
148 0.39
149 0.43
150 0.47
151 0.49
152 0.43
153 0.51
154 0.54
155 0.59
156 0.66
157 0.7
158 0.74
159 0.78
160 0.84
161 0.86
162 0.87
163 0.87
164 0.88
165 0.88
166 0.86
167 0.82
168 0.83
169 0.83
170 0.76
171 0.72
172 0.62
173 0.56
174 0.49
175 0.43
176 0.37
177 0.33
178 0.33
179 0.35
180 0.39
181 0.36
182 0.38
183 0.46
184 0.52
185 0.47
186 0.54
187 0.5
188 0.55
189 0.6
190 0.65
191 0.65
192 0.64
193 0.74
194 0.75
195 0.75
196 0.73
197 0.69
198 0.66
199 0.62
200 0.57