Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166IX88

Protein Details
Accession A0A166IX88    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
47-82GEPSDQTQLKKRKRREKEKDKKAKKRKLAESNVVITBasic
NLS Segment(s)
PositionSequence
56-73KKRKRREKEKDKKAKKRK
Subcellular Location(s) cyto 14, cyto_nucl 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MQHGGGDDLDDDFVPDDLVALSDGGEELDSASLESWTGVELDDQDGGEPSDQTQLKKRKRREKEKDKKAKKRKLAESNVVITPASVASQPPEALSEYLAQTHVKACPKLSSIELDELRIPAEWIADTSAWSTAPRTLDILPEFIGKVLPSLKTRLGQRPKNPGAPTLLFITGAALRVVDVVRILKAMKGSNPKAGDIAKLFAKHVKIEEQVHYLKRTKVGAAAGTPGRIGKLINDTDALSLSALSHIILDTSYVDKKNRSMFEIPETRQEVFQLVLDTKPIRDALASGKTSLVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.05
9 0.05
10 0.06
11 0.05
12 0.05
13 0.04
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.06
27 0.07
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.15
38 0.17
39 0.19
40 0.28
41 0.37
42 0.47
43 0.56
44 0.66
45 0.69
46 0.79
47 0.88
48 0.9
49 0.92
50 0.93
51 0.95
52 0.96
53 0.96
54 0.96
55 0.96
56 0.95
57 0.93
58 0.92
59 0.91
60 0.91
61 0.89
62 0.86
63 0.81
64 0.75
65 0.66
66 0.56
67 0.45
68 0.34
69 0.25
70 0.16
71 0.11
72 0.07
73 0.06
74 0.07
75 0.08
76 0.08
77 0.08
78 0.09
79 0.1
80 0.1
81 0.1
82 0.11
83 0.1
84 0.11
85 0.11
86 0.1
87 0.1
88 0.11
89 0.14
90 0.17
91 0.17
92 0.17
93 0.19
94 0.21
95 0.22
96 0.21
97 0.2
98 0.19
99 0.24
100 0.23
101 0.21
102 0.2
103 0.18
104 0.18
105 0.14
106 0.12
107 0.06
108 0.06
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.06
117 0.07
118 0.07
119 0.08
120 0.09
121 0.09
122 0.11
123 0.11
124 0.13
125 0.14
126 0.14
127 0.12
128 0.11
129 0.11
130 0.09
131 0.09
132 0.06
133 0.06
134 0.07
135 0.08
136 0.09
137 0.11
138 0.13
139 0.16
140 0.2
141 0.29
142 0.37
143 0.42
144 0.47
145 0.55
146 0.57
147 0.61
148 0.58
149 0.5
150 0.46
151 0.4
152 0.35
153 0.27
154 0.23
155 0.16
156 0.15
157 0.14
158 0.1
159 0.09
160 0.08
161 0.05
162 0.05
163 0.06
164 0.06
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.06
171 0.07
172 0.09
173 0.1
174 0.14
175 0.22
176 0.24
177 0.3
178 0.31
179 0.3
180 0.31
181 0.3
182 0.28
183 0.21
184 0.21
185 0.17
186 0.17
187 0.17
188 0.18
189 0.19
190 0.18
191 0.19
192 0.2
193 0.22
194 0.25
195 0.27
196 0.29
197 0.32
198 0.34
199 0.36
200 0.36
201 0.34
202 0.34
203 0.33
204 0.28
205 0.27
206 0.26
207 0.24
208 0.21
209 0.24
210 0.21
211 0.2
212 0.19
213 0.16
214 0.14
215 0.12
216 0.11
217 0.09
218 0.15
219 0.16
220 0.17
221 0.18
222 0.18
223 0.18
224 0.19
225 0.17
226 0.1
227 0.08
228 0.08
229 0.07
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.1
239 0.14
240 0.17
241 0.19
242 0.22
243 0.27
244 0.34
245 0.36
246 0.38
247 0.39
248 0.39
249 0.47
250 0.53
251 0.5
252 0.5
253 0.51
254 0.46
255 0.42
256 0.4
257 0.32
258 0.24
259 0.24
260 0.19
261 0.16
262 0.16
263 0.19
264 0.19
265 0.18
266 0.2
267 0.18
268 0.16
269 0.15
270 0.16
271 0.2
272 0.27
273 0.28
274 0.26
275 0.26