Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5PFH0

Protein Details
Accession J5PFH0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
123-148RIRTAFSKLRDPKKGRTQAQAERKTKHydrophilic
NLS Segment(s)
PositionSequence
134-138PKKGR
Subcellular Location(s) mito 17, nucl 9
Family & Domain DBs
Amino Acid Sequences MAEYLATCSFHSSRVKHFFPYVKSVAPFLLPALRLPESLPRVDIVIFNCYQRETLSRPADTLHSLPHTYTQLTVIHITHKKNDAHQKYLLQRTGKRAESGKPRSTLIVINSNTMGEIPIHSERIRTAFSKLRDPKKGRTQAQAERKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.45
4 0.51
5 0.52
6 0.49
7 0.54
8 0.48
9 0.43
10 0.42
11 0.39
12 0.33
13 0.28
14 0.24
15 0.17
16 0.17
17 0.14
18 0.13
19 0.17
20 0.17
21 0.16
22 0.17
23 0.23
24 0.22
25 0.22
26 0.22
27 0.17
28 0.18
29 0.18
30 0.19
31 0.13
32 0.15
33 0.15
34 0.15
35 0.15
36 0.14
37 0.14
38 0.13
39 0.15
40 0.14
41 0.23
42 0.26
43 0.26
44 0.26
45 0.27
46 0.27
47 0.26
48 0.23
49 0.16
50 0.14
51 0.14
52 0.14
53 0.15
54 0.15
55 0.13
56 0.13
57 0.12
58 0.11
59 0.12
60 0.13
61 0.11
62 0.15
63 0.19
64 0.19
65 0.2
66 0.25
67 0.25
68 0.3
69 0.4
70 0.38
71 0.39
72 0.41
73 0.44
74 0.46
75 0.51
76 0.5
77 0.44
78 0.43
79 0.46
80 0.5
81 0.46
82 0.42
83 0.38
84 0.4
85 0.46
86 0.51
87 0.49
88 0.45
89 0.44
90 0.42
91 0.41
92 0.38
93 0.31
94 0.31
95 0.26
96 0.26
97 0.25
98 0.24
99 0.22
100 0.19
101 0.16
102 0.07
103 0.07
104 0.1
105 0.12
106 0.14
107 0.15
108 0.15
109 0.16
110 0.19
111 0.22
112 0.19
113 0.22
114 0.27
115 0.3
116 0.4
117 0.48
118 0.54
119 0.62
120 0.66
121 0.71
122 0.75
123 0.82
124 0.77
125 0.78
126 0.78
127 0.78
128 0.83